Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | NFDPKYRFERCAKVKGICKTFCDDDEYDYGYCIKWRNQCCI |
Activity | Antibacterial |
Host Chemicals | Canis familiaris |
Length | 41 |
SwissProt ID | Q30KU3 |
1. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
3. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.