Keywords Search Google Search Search

Beta-defensin118

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2985
Sequence	AYGGEKKCWNRSGHCRKQCKDGEAVKETCKNHRACCVPSNEDH
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF2024	Palustrin-OG1 antimicrobial peptide	Inquiry
AF606	Maximin S2	Inquiry
AF2949	Liver-expressed antimicrobial peptide-2	Inquiry
AF502	Temporin-LTa	Inquiry
AF829	Maximin-Hu	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The role of Act1 in NF-кB activation

NF-кB activator 1, named Act1, is a 60-kDa (574-aa) polypeptide. Based on its interaction with IKKγ, Act1can be ...

GaTx2, a Peptide Inhibitor of ClC-2 Chloride Channels

ClC-2 chloride channels are voltage-gated ion channels that are expressed in neuronal and epithelial cells wher ...

Novel Peptide Drugs Treat Multiple Diseases (Part One)

Peptides are the ideal drug molecules because of their high affinity, high selectivity, low toxicity, and easy synthesis. Sci ...

ProTx II, a selective inhibitor of NaV1.7 sodium channel

ProTx II, a 30-amino acid, disulfide-rich peptide toxin, isolated from the venom of the tarantula, Thrixopelma ...

The opiate delta receptor antagonist-ICI 154,129

ICl 154,129 is a new compound that shows selectivity as an antagonist of [Leu5]enkephalin and [D-AIa2, D-Leu5]en ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Macaca mulatta
Length	43
SwissProt ID	Q95LI0