Keywords Search Google Search Search

Beta-purothionin

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF3154
Sequence	KSCCKSTLGRNCYNLCRARGAQKLCANVCRCKLTSGLSCPKDFPK
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF1765	Odorranain-F-OA1	Inquiry
AF1656	Maximin 42	Inquiry
AF597	Antimicrobial peptide 7	Inquiry
AF817	Maximin-H14	Inquiry
AF661	PCM19	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The efficacy of teicoplanin in the treatment of Gram-positive cocci infection

Teicoplanin is a glycopeptide antibiotic developed after vancomycin for the treatment of Gram-positive (G+) cocc ...

The effect of Sincalide on gastric movement

Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...

The Amyloid Precursor Protein and Alzheimer's Disease

The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...

The application of nafarelin acetate in hormonal therapy

Nafarelin acetate is a gonadotropin-releasing hormone (GnRH) agonist which is as effective as danazol in the tre ...

Function of ganirelix in infertility

Ganirelix, a synthetic decapeptide compound, is a gonadotrophin-releasing hormone (GnRH) antagonist preparation ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Triticum aestivum
Length	45
SwissProt ID	P01543