Keywords Search Google Search Search

Brevinin-2SN4

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF1889
Sequence	GAFGDLLKGVAKEAGLKLLNMAQCKLSGNC
Activity	Gram+ & Gram-,

CAT#	Product Name	Inquiry
AF2257	Dermaseptin-6	Inquiry
AF3037	Bacteriocin divergicin M35	Inquiry
AF901	Chemerin peptide 4	Inquiry
AF1468	Ocellatin-V3	Inquiry
AF2879	ADP-1	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Ornipressin: a synthetic derivative of vasopressin

Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...

Introduction of Pentapeptide-3

Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...

What is GHK and Copper Peptide?

Background Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be acc ...

Function of the Econazole and its derivative

Econazole, commonly used as sulfosalicylate and nitrate salt, is an imidazole broad-spectrum antifungal drug, wh ...

Function of porcine secretin on cannulation of the dorsal pancreatic duct at ERCP in patients with pancreas divisum

Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	skin, fine-spined frog, Hylarana spinulosa, Hainan, China, Asia
Length	30