Bulevirtide

Bulevirtide is a potent antiviral peptide used in the biomedical industry. It exhibits strong inhibitory activity against hepatitis delta virus (HDV), a severe co-infection with hepatitis B virus (HBV) that causes chronic liver disease.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Bulevirtide(CAS 2012558-47-1)

CAT No: R2015

CAS No:2012558-47-1

Synonyms/Alias:Bulevirtide;Bulevirtide (INN);Bulevirtide [INN];2012558-47-1;bulevirtidum;Bulevirtida;Hepcludextm;Hepcludex;Hepcludex (TN);formerly Myrcludex B;MYRCLUDEX;Bulevirtide [USAN];WKM56H3TLB;BULEVIRTIDE [WHO-DD];915207G;N-TETRADECANOYLGLYCYL-THR-ASN-LEU-SER-VAL-PRO-ASN-PRO-LEU-GLY-PHE-PHE-PRO-ASP-HIS-GLN-LEU-ASP-PRO-ALA-PHE-GLY-ALA-ASN-SER-ASN-ASN-PRO-ASP-TRP-ASP-PHE-ASN-PRO-ASN-LYS-ASP-HIS-TRP-PRO-GLU-ALA-ASN-LYS-VAL-GLY-NH2;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C248H355N65O72
M.W/Mr.
5399
Sequence
One Letter Code:GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG
Three Letter Code:myristoyl-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2
Appearance
Solid

Bulevirtide is a synthetic lipopeptide compound designed to mimic and competitively inhibit specific viral entry mechanisms at the cellular membrane. As a highly specialized peptide, it is structurally engineered to interact with the sodium taurocholate co-transporting polypeptide (NTCP), a key receptor involved in the uptake of bile acids and the entry of certain viral pathogens into hepatocytes. Its unique molecular configuration and receptor specificity have made it a valuable tool in the investigation of viral-host interactions, particularly those relevant to liver-targeting viruses. The compound's capacity to selectively block NTCP-mediated processes has established its significance in both fundamental and applied biochemical research focused on membrane transport, viral pathogenesis, and peptide-receptor binding dynamics.

Viral Entry Inhibition Studies: Bulevirtide is extensively utilized in research focused on elucidating the molecular mechanisms by which viruses, especially hepatitis B and D viruses, gain entry into hepatocytes. By serving as a potent NTCP antagonist, it enables scientists to dissect the critical steps of viral attachment and penetration at the cellular level. Experimental systems employing this peptide facilitate the identification of host-pathogen interactions, allowing for the mapping of viral entry pathways and the validation of NTCP as a principal viral receptor in hepatic tissue.

Membrane Transport Investigations: The compound's affinity for NTCP also makes it an effective probe for studying bile acid transport and the broader physiological roles of this transporter in hepatic function. Researchers employ bulevirtide to selectively inhibit NTCP-mediated uptake of bile salts, thereby modeling the consequences of transporter blockade in vitro. These studies yield insights into bile acid metabolism, transporter specificity, and the regulation of hepatic uptake processes, supporting advances in both basic liver biology and transporter-targeted drug discovery.

Peptide-Receptor Binding Analysis: As a synthetic lipopeptide with high receptor specificity, bulevirtide serves as a model ligand in receptor-ligand binding studies. Its application in biochemical assays and structural analyses provides critical data on the binding kinetics, affinity, and conformational changes associated with peptide-receptor interactions. Such investigations are instrumental for the rational design of novel peptides or small molecules targeting NTCP or similar membrane proteins, furthering the development of selective molecular probes.

Antiviral Screening Assays: Bulevirtide is incorporated into in vitro screening platforms to evaluate the efficacy of new antiviral agents targeting NTCP-dependent viral entry. By establishing a functional blockade of the receptor, it acts as a reference inhibitor, enabling comparative assessment of candidate compounds. This approach supports the identification and optimization of molecules with potential to disrupt viral infection at the entry stage, thereby contributing to the pipeline of antiviral research and development.

Cellular Model Development: In the context of advanced cell culture systems, bulevirtide is used to generate NTCP-deficient models or to transiently inhibit NTCP function in hepatocyte-derived cell lines. These tailored cellular models are critical for studying the physiological and pathological roles of NTCP, as well as for dissecting the impact of transporter inhibition on cellular homeostasis, signaling pathways, and susceptibility to viral infection. The use of this peptide thus underpins the creation of robust experimental platforms for liver biology and infectious disease research.

InChI
InChI=1S/C248H355N65O72/c1-16-17-18-19-20-21-22-23-24-25-38-75-193(327)265-118-196(330)304-205(133(15)316)241(378)295-163(104-188(256)322)224(361)283-152(91-127(6)7)216(353)303-175(122-315)232(369)306-204(129(10)11)248(385)313-88-53-74-182(313)239(376)301-172(107-191(259)325)246(383)312-87-50-70-178(312)235(372)291-150(89-125(2)3)209(346)268-120-195(329)274-154(93-135-56-32-27-33-57-135)217(354)296-168(95-137-60-36-29-37-61-137)242(379)308-83-49-72-180(308)237(374)294-167(111-201(339)340)230(367)286-157(98-140-115-261-123-269-140)220(357)277-148(76-78-183(251)317)213(350)282-151(90-126(4)5)215(352)300-173(112-202(341)342)247(384)307-82-47-68-176(307)233(370)273-132(14)208(345)279-153(92-134-54-30-26-31-55-134)210(347)267-119-194(328)271-130(12)206(343)280-160(101-185(253)319)226(363)302-174(121-314)231(368)288-161(102-186(254)320)225(362)299-171(106-190(258)324)245(382)311-86-52-73-181(311)238(375)293-166(110-200(337)338)229(366)285-156(96-138-113-263-144-64-41-39-62-142(138)144)219(356)290-165(109-199(335)336)227(364)284-155(94-136-58-34-28-35-59-136)218(355)298-170(105-189(257)323)244(381)310-85-51-71-179(310)236(373)292-162(103-187(255)321)223(360)275-146(66-43-45-80-249)212(349)289-164(108-198(333)334)228(365)287-158(99-141-116-262-124-270-141)221(358)297-169(97-139-114-264-145-65-42-40-63-143(139)145)243(380)309-84-48-69-177(309)234(371)278-149(77-79-197(331)332)211(348)272-131(13)207(344)281-159(100-184(252)318)222(359)276-147(67-44-46-81-250)214(351)305-203(128(8)9)240(377)266-117-192(260)326/h26-37,39-42,54-65,113-116,123-133,146-182,203-205,263-264,314-316H,16-25,38,43-53,66-112,117-122,249-250H2,1-15H3,(H2,251,317)(H2,252,318)(H2,253,319)(H2,254,320)(H2,255,321)(H2,256,322)(H2,257,323)(H2,258,324)(H2,259,325)(H2,260,326)(H,261,269)(H,262,270)(H,265,327)(H,266,377)(H,267,347)(H,268,346)(H,271,328)(H,272,348)(H,273,370)(H,274,329)(H,275,360)(H,276,359)(H,277,357)(H,278,371)(H,279,345)(H,280,343)(H,281,344)(H,282,350)(H,283,361)(H,284,364)(H,285,366)(H,286,367)(H,287,365)(H,288,368)(H,289,349)(H,290,356)(H,291,372)(H,292,373)(H,293,375)(H,294,374)(H,295,378)(H,296,354)(H,297,358)(H,298,355)(H,299,362)(H,300,352)(H,301,376)(H,302,363)(H,303,353)(H,304,330)(H,305,351)(H,306,369)(H,331,332)(H,333,334)(H,335,336)(H,337,338)(H,339,340)(H,341,342)/t130-,131-,132-,133+,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,156-,157-,158-,159-,160-,161-,162-,163-,164-,165-,166-,167-,168-,169-,170-,171-,172-,173-,174-,175-,176-,177-,178-,179-,180-,181-,182-,203-,204-,205-/m0/s1
InChI Key
WQNDXLHKAMIGEX-WOAPPVHJSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Nucleic Acids SynthesisEpitope Mapping ServicesPeptide Synthesis ServicescGMP Peptide ServicePeptide Analysis ServicesCustom Conjugation ServicePeptide Modification ServicesPeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers