Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C151H226N40O45S3 |
M.W/Mr. | 3417.90 |
Sequence | CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 |
Length | 32 |
1. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
3. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.