CAT# | C06009 |
M.F/Formula | C151H226N40O45S3 |
M.W/Mr. | 3417.90 |
Sequence | CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 |
Length | 32 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
C06022 | Biotinyl-(Cys1,Lys(biotinyl)18)-Calcitonin (human) | Inquiry | ||
C06001 | Calcitonin C-terminal Adjacent Peptide, rat | Inquiry | ||
C06023 | Biotinyl-Calcitonin (salmon I) | Inquiry | ||
C06003 | Calcitonin C-Terminal Flanking Peptide (human) | Inquiry | ||
C06008 | Calcitonin, eel | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Antioxidant effect of peptides Peptides have been isolated from the resultant by-products in the past 15 years and suggested ...
st-Ht31, a protein kinase A (PKA)-anchoring inhibitor, greatly induces robust cholesterol or phospholipid effl ...
Astressin 2B is a peptidic antagonist to CRF2 (corticotrophin-releasing factor 2) receptor with structure of cyc ...
ClC-2 chloride channels are voltage-gated ion channels that are expressed in neuronal and epithelial cells wher ...
KAI-1455, a ε-protein kinase C activator in Phase I testing for the treatment of ischemia-induced reperfusion i ...