Keywords Search Google Search Search

Calcitonin (salmon I)

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	C06010
M.F/Formula	C145H240N44O48S2
M.W/Mr.	3431.90
Sequence	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2

CAT#	Product Name	Inquiry
C06012	Calcitonin, porcine	Inquiry
C06022	Biotinyl-(Cys1,Lys(biotinyl)18)-Calcitonin (human)	Inquiry
C06001	Calcitonin C-terminal Adjacent Peptide, rat	Inquiry
C06011	Glu20-salmon calcitonin	Inquiry
C06009	Calcitonin (human)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Application of ZIP to block the constitutive activity of PKMζ

Long-term potentiation (LTP) is a persistent synaptic enhancement which is thought to be a substrate for memory. ...

Calcitonin

Discovery and Structure Calcitonin, also called thyrocalcitonin, a protein hormone synthesized and secreted in humans and oth ...

Obtustatin: a potent selective α1β1 inhibitor

Obtustatin isolated from the venom of the Vipera lebetina obtusa viper is a highly potent integrin α1β1 inhibito ...

Function of acetyl glutamyl heptapeptide-3 in skin

Acetyl Glutamyl Heptapeptide-3, named SNAP-8, Acetyl GlutaMyl Octapeptide-3, Acetyl Octapeptide-1, Acetyl Octape ...

St-Ht31 P, an AKAP inhibitor

The peptide st-Ht31 P, A-kinase anchoring protein (AKAP) inhibitor, has the negative control for st-Ht31. In DRG ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: