CAT# | C06010 |
M.F/Formula | C145H240N44O48S2 |
M.W/Mr. | 3431.90 |
Sequence | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 |
Length | 32 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
C06007 | Calcitonin, rat | Inquiry | ||
C06021 | (Des-Cys1,cyclo(Ser2-Asu7))-Calcitonin (eel) | Inquiry | ||
C06022 | Biotinyl-(Cys1,Lys(biotinyl)18)-Calcitonin (human) | Inquiry | ||
C06023 | Biotinyl-Calcitonin (salmon I) | Inquiry | ||
C06009 | Calcitonin (human) | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...
Cyclotraxin B , a potent antagonist of TrkB receptors, inhibits BDNF-induced TrkB activity (IC50 = 0.30 nM). R ...
Dalbavancin, marketed under the brand name of Dalvance, is a new semi-synthetic glycopeptide antibiotic for anti ...
The serine/threonine kinase Pim-1 plays an important role in cell cycle progression and apoptosis inhibition, re ...
Leuprolide acetate, an acetate salt with similar structure to luteinizing hormone-releasing hormone (LHRH) secre ...