Cecropin B

Cecropin B is an antibacterial peptide isolated from pig intestine and moths. This peptide inhibits proline uptake in bacteria by lysing cell membranes and making them leaky.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Cecropin B(CAS 80451-05-4)

CAT No: R1863

CAS No:80451-05-4

Synonyms/Alias:Cecropin B;80451-05-4;cecropin B protein, Insecta;P9B Protein;P9B protein, Insecta;P9B protein, Hyalophora cecropia;Cecropin B protein, Hyalophora cecropia;DTXSID90230334;Cecropin B protein,Insecta;CHEMBL1673088;DTXCID90152825;EX-A7391;DA-62171;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C176H302N52O41S
M.W/Mr.
3835
Sequence
One Letter Code:KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL
Three Letter Code:H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
Purity
≥97% (HPLC)
Activity
Antimicrobial

Cecropin B is a naturally occurring antimicrobial peptide originally isolated from the hemolymph of the cecropia moth, and it has since become a focal point in peptide biochemistry due to its potent broad-spectrum activity against both Gram-positive and Gram-negative bacteria. Structurally, it is characterized by an amphipathic alpha-helical conformation, which underpins its ability to interact with and disrupt microbial membranes. As a member of the cecropin family, this peptide is widely recognized for its role in innate immunity and is frequently employed in laboratory investigations to elucidate mechanisms of host defense, membrane interactions, and peptide-microbe dynamics. Its unique physicochemical properties and biological activity make it a valuable tool in multiple domains of biochemical and microbiological research.

Antimicrobial mechanism studies: Cecropin B serves as a model compound in the study of peptide-mediated membrane disruption. Researchers utilize it to investigate how cationic amphipathic peptides interact with lipid bilayers, leading to pore formation or membrane destabilization in bacterial cells. These studies provide insights into the fundamental processes underlying peptide-induced lysis and help delineate the structure-activity relationships that govern antimicrobial efficacy. The peptide's well-characterized sequence and mode of action make it an ideal subject for dissecting the molecular basis of peptide-membrane interactions.

Peptide engineering and design: The robust antimicrobial profile and defined structure of cecropin peptides have inspired extensive work in the field of peptide engineering. Cecropin B is often used as a template for the rational design of novel synthetic analogues with enhanced stability, selectivity, or activity. By systematically modifying its amino acid sequence, researchers can probe the determinants of antimicrobial potency and specificity, facilitating the development of next-generation antimicrobial peptides for research applications. This approach supports the optimization of peptide-based research tools and the exploration of structure-function relationships in synthetic biology.

Innate immunity modeling: In immunological research, cecropin B is employed to model aspects of innate immune defense mechanisms, particularly in invertebrate and lower vertebrate systems. Its activity profile and evolutionary conservation make it valuable for comparative studies investigating how organisms utilize peptide-based effectors to counter microbial invasion. Such models contribute to a deeper understanding of the evolutionary pressures shaping immune system diversity and the molecular strategies used by hosts to detect and neutralize pathogens.

Biofilm inhibition assays: The peptide's ability to disrupt bacterial communities extends to the inhibition of biofilm formation, a key factor in microbial persistence and resistance. Cecropin B is utilized in laboratory assays to assess its effects on biofilm development, architecture, and viability. These studies are critical for elucidating the mechanisms by which antimicrobial peptides affect sessile bacterial populations and for identifying potential research leads in the study of microbial adhesion, surface colonization, and resistance phenotypes.

Analytical and detection tool: Beyond its direct antimicrobial effects, cecropin B is applied as a functional probe in various analytical contexts. Its selective interaction with bacterial membranes enables its use in assays designed to detect or quantify microbial contamination in research samples. By incorporating labeled or modified versions of the peptide, scientists can develop sensitive detection platforms for microbiological quality control, facilitating the rapid assessment of bacterial presence in experimental systems. This application underscores the versatility of cecropin-derived peptides as both research reagents and analytical tools in the broader field of microbiological and biochemical investigation.

Source#
Synthetic
Host Chemicals
Hyalophora cecropia
Length
37
Long-term Storage Conditions
Soluble in water
Shipping Condition
Wet ice in continental US; may vary elsewhere
InChI
InChI=1S/C176H302N52O41S/c1-25-97(15)140(174(269)224-139(96(13)14)168(263)212-113(57-36-43-72-179)155(250)199-101(19)145(240)198-91-134(234)228-79-50-64-128(228)167(262)202-104(22)149(244)225-141(98(16)26-2)171(266)203-105(23)148(243)222-137(94(9)10)169(264)219-123(82-93(7)8)152(247)196-89-132(232)205-119(65-67-135(235)236)156(251)201-102(20)146(241)206-112(56-35-42-71-178)154(249)200-103(21)147(242)215-122(144(187)239)81-92(5)6)221-133(233)90-197-153(248)126(85-129(185)229)217-160(255)118(63-49-78-193-176(190)191)213-172(267)143(100(18)28-4)227-166(261)127(86-130(186)230)218-157(252)111(62-48-77-192-175(188)189)204-131(231)88-195-151(246)121(69-80-270-24)211-159(254)114(58-37-44-73-180)207-161(256)120(66-68-136(237)238)214-173(268)142(99(17)27-3)226-163(258)117(61-40-47-76-183)208-158(253)115(59-38-45-74-181)209-164(259)124(83-106-51-30-29-31-52-106)220-170(265)138(95(11)12)223-162(257)116(60-39-46-75-182)210-165(260)125(216-150(245)109(184)54-34-41-70-177)84-107-87-194-110-55-33-32-53-108(107)110/h29-33,51-53,55,87,92-105,109,111-128,137-143,194H,25-28,34-50,54,56-86,88-91,177-184H2,1-24H3,(H2,185,229)(H2,186,230)(H2,187,239)(H,195,246)(H,196,247)(H,197,248)(H,198,240)(H,199,250)(H,200,249)(H,201,251)(H,202,262)(H,203,266)(H,204,231)(H,205,232)(H,206,241)(H,207,256)(H,208,253)(H,209,259)(H,210,260)(H,211,254)(H,212,263)(H,213,267)(H,214,268)(H,215,242)(H,216,245)(H,217,255)(H,218,252)(H,219,264)(H,220,265)(H,221,233)(H,222,243)(H,223,257)(H,224,269)(H,225,244)(H,226,258)(H,227,261)(H,235,236)(H,237,238)(H4,188,189,192)(H4,190,191,193)/t97-,98-,99-,100-,101-,102-,103-,104-,105-,109-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,137-,138-,139-,140-,141-,142-,143-/m0/s1
InChI Key
YIQHNFUJWYYSEC-MQAAYMCRSA-N
Canonical SMILES
CCC(C)C(C(=O)NC(C(C)C)C(=O)NC(CCCCN)C(=O)NC(C)C(=O)NCC(=O)N1CCCC1C(=O)NC(C)C(=O)NC(C(C)CC)C(=O)NC(C)C(=O)NC(C(C)C)C(=O)NC(CC(C)C)C(=O)NCC(=O)NC(CCC(=O)O)C(=O)NC(C)C(=O)NC(CCCCN)C(=O)NC(C)C(=O)NC(CC(C)C)C(=O)N)NC(=O)CNC(=O)C(CC(=O)N)NC(=O)C(CCCNC(=N)N)NC(=O)C(C(C)CC)NC(=O)C(CC(=O)N)NC(=O)C(CCCNC(=N)N)NC(=O)CNC(=O)C(CCSC)NC(=O)C(CCCCN)NC(=O)C(CCC(=O)O)NC(=O)C(C(C)CC)NC(=O)C(CCCCN)NC(=O)C(CCCCN)NC(=O)C(CC2=CC=CC=C2)NC(=O)C(C(C)C)NC(=O)C(CCCCN)NC(=O)C(CC3=CNC4=CC=CC=C43)NC(=O)C(CCCCN)N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesPeptide Synthesis ServicesPeptide Nucleic Acids SynthesiscGMP Peptide ServiceEpitope Mapping ServicesPeptide Analysis ServicesPeptide CDMOCustom Conjugation Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers