CAT# | AF2361 |
Sequence | GRLKKLGKKIEKAGKRVFNAVQKGLPVAAGVQAL |
Activity | Antibacterial |
Host Chemicals | Culex pipiens pipiens | Length | 34 | SwissProt ID | Q86PR5 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1304 | Brevinin-1PLc | Inquiry | ||
AF2880 | Human beta-defensin-2 WT hBD - 2 | Inquiry | ||
AF3036 | Divercin V41 | Inquiry | ||
AF3285 | Ac-AFP2 | Inquiry | ||
AF2568 | Pilosulin 5 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
GsMTx4 is a synthetic and biologically active peptide toxin. Its molecular formula is C185H273N49O45S6, with the ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...
Tetracosactide (also known as Tetracosactide) is a synthetic peptide that is identical to the 24-amino acid segm ...
Proteolytic Processing of APP Following discovery of the full-length APP cDNA clone, numerous studies were undertaken to dete ...
Studies on the binding affinities of darifenacin hydrobromide and human muscarinic receptor subtypes show strong ...