We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | QRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGC |
Activity | Antibacterial, Antifungal |
Host Chemicals | Triticum kiharae |
Length | 43 |
SwissProt ID | P85966 |
1. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
2. Emu oil in combination with other active ingredients for treating skin imperfections
3. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
4. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
Required fields are marked with *
×Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.