Cn2 toxin

Cn2 Toxin is a scorpion venom peptide stabilized by multiple disulfide bonds, producing a rigid scaffold suited for ion-channel interrogation. The structured loops formed by cysteines generate selective channel-binding surfaces. Researchers characterize its conformational constraints using electrophysiology and spectroscopy. Applications include toxin engineering, ion-channel mapping, and disulfide-rich peptide analysis.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2845

Synonyms/Alias:beta-scorpion toxin Cn2; beta-mammal toxin Cn2; Toxin 2; Toxin II.9.2.2; GTPL2632

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C336H496N90O96S8
M.W/Mr.
7588.6
Sequence
One Letter Code:KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS-NH2 (Disulfide bridge:Cys12-Cys65;Cys16-Cys41;Cys25-Cys46;Cys29-Cys48)
Three Letter Code:Lys-Glu-Gly-Tyr-Leu-Val-Asp-Lys-Asn-Thr-Gly-Cys-Lys-Tyr-Glu-Cys-Leu-Lys-Leu-Gly-Asp-Asn-Asp-Tyr-Cys-Leu-Arg-Glu-Cys-Lys-Gln-Gln-Tyr-Gly-Lys-Gly-Ala-Gly-Gly-Tyr-Cys-Tyr-Ala-Phe-Ala-Cys-Trp-Cys-Thr-His-Leu-Tyr-Glu-Gln-Ala-Ile-Val-Trp-Pro-Leu-Pro-Asn-Lys-Arg-Cys-Ser-NH2 (Disulfide bridge:Cys12-Cys65;Cys16-Cys41;Cys25-Cys46;Cys29-Cys48)

Cn2 toxin, a scorpion-derived peptide toxin, has garnered significant attention in scientific research due to its unique ability to selectively interact with voltage-gated sodium channels. As a member of the α-toxin family, this compound is characterized by a highly conserved structure that facilitates stable binding to its molecular targets. Its specificity and potency make it an invaluable tool for dissecting the physiological and pharmacological properties of neuronal and muscular sodium channels. Researchers value this toxin for its reproducible effects and well-documented mechanism of action, which have enabled a deeper understanding of ion channel modulation and signal transduction in excitable tissues. The stability and purity of Cn2 toxin further enhance its suitability for a range of experimental settings, from basic neurobiology to advanced electrophysiological studies.

Ion Channel Research: Cn2 toxin is extensively utilized in the field of ion channel research, where it serves as a molecular probe to investigate the structure and function of voltage-gated sodium channels. By selectively binding to site 3 on the channel, this peptide inhibits the inactivation process, prolonging sodium influx and thereby altering action potential dynamics. Such precise modulation allows for detailed mapping of channel subtypes and elucidation of their roles in neuronal signaling. Its application has significantly advanced the understanding of channelopathies and contributed to the identification of novel therapeutic targets for neurological disorders.

Neurophysiology Studies: In neurophysiology, Cn2 toxin is employed to study the excitability of neurons and the propagation of action potentials. Its ability to modify sodium channel kinetics offers researchers a powerful means to dissect the contributions of specific channel isoforms to neuronal firing patterns. Experimental protocols often involve the application of this toxin to isolated neurons or brain slices, enabling real-time observation of changes in membrane potential and synaptic transmission. Such studies have provided critical insights into the mechanisms underlying neural coding and information processing in the central and peripheral nervous systems.

Pharmacological Screening: The toxin's selective action on sodium channels renders it a valuable tool in pharmacological screening assays. It is commonly used to validate the efficacy and selectivity of new sodium channel modulators, assisting in the early stages of drug discovery. By serving as a reference compound, it aids in distinguishing between compounds that target channel inactivation versus those that affect activation or conductance. Its inclusion in high-throughput screening platforms has streamlined the identification of promising lead molecules for further development in neuropharmacology and pain management research.

Comparative Toxinology: Cn2 toxin is also instrumental in comparative toxinology, where it is used to analyze the evolutionary relationships and functional diversity of scorpion toxins. Researchers compare its sequence, structure, and bioactivity with those of other α-toxins to uncover patterns of molecular adaptation and species-specific channel targeting. These comparative studies have broadened the understanding of toxin evolution and provided a framework for engineering novel peptide analogs with tailored properties for research and therapeutic applications.

Biophysical Characterization: In the realm of biophysics, Cn2 toxin enables detailed characterization of sodium channel gating mechanisms and conformational changes. Techniques such as patch-clamp electrophysiology and fluorescence spectroscopy are employed to monitor the dynamic interactions between the toxin and channel proteins. These experiments yield high-resolution data on binding kinetics, channel modulation, and allosteric effects, contributing to the development of refined models of ion channel function. The insights gained from such studies are instrumental in guiding the rational design of next-generation channel modulators and advancing the broader field of membrane protein research.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicePeptide Analysis ServicescGMP Peptide ServicePeptide CDMOPeptide Nucleic Acids SynthesisPeptide Modification ServicesPeptide Synthesis ServicesEpitope Mapping Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers