Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C₁₇₇H₂₇₉N₄₉O₅₈ |
M.W/Mr. | 4021.46 |
Sequence | One Letter Code: ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY three Letter Code: H-Phe-Arg-Ala-Asp-His-Pro-Phe-Leu-OH trifluoroacetate salt |
Source# | Synthetic |
2. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
3. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
5. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.