Copeptin (human) trifluoroacetate salt

Copeptin (human) trifluoroacetate salt represents the C-terminal segment of pre-pro-hormonal processing, offering excellent stability in biochemical workflows. Its amphipathic nature supports folding and interaction analyses within neuroendocrine research. The peptide helps elucidate precursor maturation, peptide trafficking, and sequence-dependent stability. Applications extend to secretion studies and structure-function assays.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: C0031

CAS No:78362-34-2

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₁₇₇H₂₇₉N₄₉O₅₈
M.W/Mr.
4021.46
Sequence
One Letter Code: ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY
three Letter Code: H-Phe-Arg-Ala-Asp-His-Pro-Phe-Leu-OH trifluoroacetate salt
Source#
Synthetic

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServicePeptide Nucleic Acids SynthesisPeptide Modification ServicesEpitope Mapping ServicesCustom Conjugation ServicePeptide Analysis ServicesPeptide Synthesis ServicesPeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers