1. Home
  2. Products
  3. Catalog Peptides
  4. Others Catalog Peptides
  5. Copeptin (rat) trifluoroacetate salt

Copeptin (rat) trifluoroacetate salt

Copeptin (rat) trifluoroacetate salt represents the terminal region of a precursor peptide used to explore secretion pathways in rodent models. Its amphipathic features support folding and stability studies across biochemical systems. The peptide assists in analyzing species-specific processing events and protein maturation. Applications extend to neuroendocrine research, peptide trafficking, and structural studies.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: C0032

CAS No:86280-64-0

Synonyms/Alias:Copeptin (rat);86280-64-0;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C183H307N57O61
M.W/Mr.
4282
Sequence
One Letter Code:AREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY
Three Letter Code:H-Ala-Arg-Glu-Gln-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Arg-Glu-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Thr-Gln-Glu-Ser-Val-Asp-Ser-Ala-Lys-Pro-Arg-Val-Tyr-OH
Source#
Synthetic
InChI
InChI=1S/C183H307N57O61/c1-81(2)66-111(160(281)205-91(20)144(265)203-76-131(252)234-141(95(24)244)176(297)218-104(46-53-127(187)248)152(273)215-109(51-58-135(258)259)158(279)232-123(80-243)170(291)237-139(88(15)16)174(295)229-119(75-137(262)263)166(287)233-121(78-241)168(289)207-92(21)146(267)220-110(34-26-27-59-184)178(299)240-65-33-40-125(240)172(293)216-102(38-31-63-202-183(197)198)159(280)235-140(89(17)18)175(296)230-120(179(300)301)72-97-41-43-98(246)44-42-97)221-154(275)105(47-54-128(188)249)217-173(294)138(87(13)14)236-167(288)116(71-86(11)12)224-151(272)101(37-30-62-201-182(195)196)211-162(283)112(67-82(3)4)225-164(285)115(70-85(9)10)226-163(284)113(68-83(5)6)223-156(277)108(50-57-134(256)257)214-150(271)100(36-29-61-200-181(193)194)210-145(266)93(22)208-171(292)124-39-32-64-239(124)132(253)77-204-148(269)118(74-136(260)261)228-165(286)114(69-84(7)8)222-155(276)106(48-55-129(189)250)219-177(298)142(96(25)245)238-147(268)94(23)206-161(282)117(73-130(190)251)227-169(290)122(79-242)231-157(278)103(45-52-126(186)247)212-153(274)107(49-56-133(254)255)213-149(270)99(209-143(264)90(19)185)35-28-60-199-180(191)192/h41-44,81-96,99-125,138-142,241-246H,26-40,45-80,184-185H2,1-25H3,(H2,186,247)(H2,187,248)(H2,188,249)(H2,189,250)(H2,190,251)(H,203,265)(H,204,269)(H,205,281)(H,206,282)(H,207,289)(H,208,292)(H,209,264)(H,210,266)(H,211,283)(H,212,274)(H,213,270)(H,214,271)(H,215,273)(H,216,293)(H,217,294)(H,218,297)(H,219,298)(H,220,267)(H,221,275)(H,222,276)(H,223,277)(H,224,272)(H,225,285)(H,226,284)(H,227,290)(H,228,286)(H,229,295)(H,230,296)(H,231,278)(H,232,279)(H,233,287)(H,234,252)(H,235,280)(H,236,288)(H,237,291)(H,238,268)(H,254,255)(H,256,257)(H,258,259)(H,260,261)(H,262,263)(H,300,301)(H4,191,192,199)(H4,193,194,200)(H4,195,196,201)(H4,197,198,202)/t90-,91-,92-,93-,94-,95+,96+,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,138-,139-,140-,141-,142-/m0/s1
InChI Key
VVYCCODTXZTDCZ-VTPLTZEHSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOPeptide Analysis ServicesCustom Conjugation ServicecGMP Peptide ServicePeptide Nucleic Acids SynthesisPeptide Synthesis ServicesPeptide Modification ServicesEpitope Mapping Services
Hot Products
Lanreotide Acetate

Lanreotide Acetate is a somatostatin analog peptide regulating hormone secretion. Purchase Lanreotide peptide online to study tumor suppression and endocrine disorders.

Read More Read More
Gonadorelin Acetate

Gonadorelin Acetate stimulates LH and FSH release in fertility research. Purchase Gonadorelin peptide powder from a verified peptide supplier for reproductive studies.

Read More Read More
Teriparatide Acetate

Teriparatide Acetate is a bone-forming peptide supporting osteoporosis research. Buy Teriparatide peptide online to study bone growth and calcium metabolism.

Read More Read More
Buserelin Acetate

Buserelin Acetate is a GnRH agonist peptide regulating reproductive hormones. Buy Buserelin peptide powder online to explore fertility and hormone-dependent tumor research.

Read More Read More
DOTA-cyclo(RGDfK) acetate

DOTA-cyclo(RGDfK) acetate is a metal-chelating cyclic RGD peptide used to investigate integrin-binding motifs. Its cyclized structure stabilizes ligand presentation for receptor-targeting studies. Researchers analyze its conformation for high-affinity binding models. The DOTA moiety supports imaging-related biochemical experiments.

Read More Read More
Deslorelin

Deslorelin peptide is a potent GnRH agonist used for fertility and hormonal control. Buy Deslorelin peptide powder online for veterinary and endocrine research applications.

Read More Read More
Antide

Antide is a GnRH antagonist peptide used in reproductive hormone research. Buy Antide peptide powder from a reliable peptide supplier for endocrine studies.

Read More Read More
GLP-1 (7-36) amide Acetate

GLP-1 (7-36) amide Acetate peptide enhances insulin secretion and glucose balance. Buy this research peptide for diabetes and metabolic disorder studies.

Read More Read More
Teduglutide

Teduglutide peptide enhances intestinal absorption and mucosal growth. Buy Teduglutide research peptide to support gastrointestinal and metabolic studies.

Read More Read More
Terlipressin

Terlipressin is a synthetic vasopressin analog that supports vascular and renal research. Purchase Terlipressin peptide from a verified supplier for liver and hemodynamic studies.

Read More Read More
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers