Copeptin (rat) trifluoroacetate salt

Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

CAT No: C0032

CAS No: 86280-64-0

Synonyms/Alias: Copeptin (rat);86280-64-0;

Quick InquiryCustom Peptide Synthesis

Peptide Library Construction and Screening

Powerful screening tools in biological and chemical research

M.F/FormulaC183H307N57O61
M.W/Mr.4282
SequenceOne Letter Code:AREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY
Three Letter Code:H-Ala-Arg-Glu-Gln-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Arg-Glu-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Thr-Gln-Glu-Ser-Val-Asp-Ser-Ala-Lys-Pro-Arg-Val-Tyr-OH
Source#Synthetic
InChIInChI=1S/C183H307N57O61/c1-81(2)66-111(160(281)205-91(20)144(265)203-76-131(252)234-141(95(24)244)176(297)218-104(46-53-127(187)248)152(273)215-109(51-58-135(258)259)158(279)232-123(80-243)170(291)237-139(88(15)16)174(295)229-119(75-137(262)263)166(287)233-121(78-241)168(289)207-92(21)146(267)220-110(34-26-27-59-184)178(299)240-65-33-40-125(240)172(293)216-102(38-31-63-202-183(197)198)159(280)235-140(89(17)18)175(296)230-120(179(300)301)72-97-41-43-98(246)44-42-97)221-154(275)105(47-54-128(188)249)217-173(294)138(87(13)14)236-167(288)116(71-86(11)12)224-151(272)101(37-30-62-201-182(195)196)211-162(283)112(67-82(3)4)225-164(285)115(70-85(9)10)226-163(284)113(68-83(5)6)223-156(277)108(50-57-134(256)257)214-150(271)100(36-29-61-200-181(193)194)210-145(266)93(22)208-171(292)124-39-32-64-239(124)132(253)77-204-148(269)118(74-136(260)261)228-165(286)114(69-84(7)8)222-155(276)106(48-55-129(189)250)219-177(298)142(96(25)245)238-147(268)94(23)206-161(282)117(73-130(190)251)227-169(290)122(79-242)231-157(278)103(45-52-126(186)247)212-153(274)107(49-56-133(254)255)213-149(270)99(209-143(264)90(19)185)35-28-60-199-180(191)192/h41-44,81-96,99-125,138-142,241-246H,26-40,45-80,184-185H2,1-25H3,(H2,186,247)(H2,187,248)(H2,188,249)(H2,189,250)(H2,190,251)(H,203,265)(H,204,269)(H,205,281)(H,206,282)(H,207,289)(H,208,292)(H,209,264)(H,210,266)(H,211,283)(H,212,274)(H,213,270)(H,214,271)(H,215,273)(H,216,293)(H,217,294)(H,218,297)(H,219,298)(H,220,267)(H,221,275)(H,222,276)(H,223,277)(H,224,272)(H,225,285)(H,226,284)(H,227,290)(H,228,286)(H,229,295)(H,230,296)(H,231,278)(H,232,279)(H,233,287)(H,234,252)(H,235,280)(H,236,288)(H,237,291)(H,238,268)(H,254,255)(H,256,257)(H,258,259)(H,260,261)(H,262,263)(H,300,301)(H4,191,192,199)(H4,193,194,200)(H4,195,196,201)(H4,197,198,202)/t90-,91-,92-,93-,94-,95+,96+,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,138-,139-,140-,141-,142-/m0/s1
InChI KeyVVYCCODTXZTDCZ-VTPLTZEHSA-N
Write a review Ask a question
My Review for Copeptin (rat) trifluoroacetate salt

Required fields are marked with *

  • Basic Information
×
Ask a Question for Copeptin (rat) trifluoroacetate salt

Required fields are marked with *

  • Basic Information
×
Featured Recommendations
Related Screening Libraries:
Related Small Molecules:
Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.

Featured Services
Hot Products
  • Fertirelin Acetate

    Fertirelin acetate is a potent LHRH agonist. After a transient increase, continuous administration results in downregulation of LH and FSH levels followed by a suppression of ovarian and testicular steroid biosynthesis.

    Inquiry
  • Alarelin acetate

    Alarelin acetate is a synthetic LH-RH agonist, and stimulates the release of FSH and LH from the pituitary gland. It is known for its induction of ovulation and used to treat endmometriosis.

    Inquiry
  • Somatostatin

    Somatostatin is a tetradecapeptide which can suppress the growth hormone (GH) secretion and control the pituitary hormone secretion in human CNS.

    Inquiry
  • Teriparatide Acetate

    Teriparatide(recombinant human parathyroid hormone) /PTH (1-34) (human) corresponds to the N-terminal part of human parathyroid hormone, a peptide consisting of 84 amino acids.

    Inquiry
  • Deslorelin Acetate

    Deslorelin acetate is an injectable gonadotropin releasing hormone super-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen).

    Inquiry
  • Angiotensin II Acetate

    Angiotensin II is an octapeptide that produced from angiotensin I after the removal of two amino acids at the C-terminal by angiotensin-converting enzyme (ACE). Angiotensin II is mediated by AT1 and AT2 receptors, which are seven transmembrane glycoproteins with 30% sequence similarity.

    Inquiry
  • Buserelin Acetate

    Buserelin Acetate is an agonist of gonadotropin-releasing hormone receptor(GnRHR). Buserelin is a synthetic luteinizing hormone–releasing hormone (LHRH) analog.

    Inquiry
  • Atosiban

    Atosiban is a nonapeptide, desamino-oxytocin analogue, and a competitive vasopressin/oxytocin receptor antagonist (VOTra). Atosiban is indicated to delay imminent pre-term birth in pregnant adult women. Atosiban is useful in improving the pregnancy outcome of in vitro fertilization-embryo transfer (IVF-ET) in patients with repeated implantation failure (RIF). The pregnancy rate improved from zero to 43.7%.

    Inquiry
  • Angiotensin II

    Angiotensin II human (Angiotensin II) is a vasoconstrictor that mainly acts on the AT1 receptor. Angiotensin II human stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions. Angiotensin II human induces growth of vascular smooth muscle cells, increases collagen type I and III synthesis in fibroblasts, leading to thickening of the vascular wall and myocardium, and fibrosis. Angiotensin II human also induces apoptosis.

    Inquiry
  • Fertirelin Acetate

    Fertirelin acetate is a potent LHRH agonist. After a transient increase, continuous administration results in downregulation of LH and FSH levels followed by a suppression of ovarian and testicular steroid biosynthesis.

    Inquiry
  • Alarelin acetate

    Alarelin acetate is a synthetic LH-RH agonist, and stimulates the release of FSH and LH from the pituitary gland. It is known for its induction of ovulation and used to treat endmometriosis.

    Inquiry
  • Somatostatin

    Somatostatin is a tetradecapeptide which can suppress the growth hormone (GH) secretion and control the pituitary hormone secretion in human CNS.

    Inquiry
  • Teriparatide Acetate

    Teriparatide(recombinant human parathyroid hormone) /PTH (1-34) (human) corresponds to the N-terminal part of human parathyroid hormone, a peptide consisting of 84 amino acids.

    Inquiry
  • Deslorelin Acetate

    Deslorelin acetate is an injectable gonadotropin releasing hormone super-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen).

    Inquiry
Get in touch with us

Copyright © 2025 Creative Peptides. All rights reserved.

We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy

Accept Cookies
x