CRAMP (mouse)

Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

CAT No: C4801

CAS No: 376364-36-2

Synonyms/Alias: 376364-36-2;CHEMBL1275613;CRAMP (mouse) trifluoroacetate salt;FC109865;CATHELICIDIN RELATED ANTIMICROBIAL PEPTIDE (MOUSE);H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Gl u-Gln-OH; H-GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH;

Quick InquiryCustom Peptide Synthesis

Peptide Library Construction and Screening

Powerful screening tools in biological and chemical research

M.F/FormulaC178H302N50O46
M.W/Mr.3879
SequenceOne Letter Code:GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Three Letter Code:H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH
InChIInChI=1S/C178H302N50O46/c1-17-102(14)146(224-160(256)112(54-31-39-79-184)207-150(246)108(50-27-35-75-180)210-164(260)124(86-98(6)7)217-152(248)109(51-28-36-76-181)205-156(252)118(65-72-143(241)242)202-141(238)96-199-173(269)147(103(15)18-2)225-161(257)113(55-32-40-80-185)209-157(253)117(64-71-142(239)240)201-139(236)94-196-138(235)93-197-149(245)107(49-26-34-74-179)204-151(247)115(57-42-82-195-178(193)194)211-165(261)125(87-99(8)9)219-163(259)123(85-97(4)5)203-137(234)92-187)172(268)198-95-140(237)200-116(60-67-132(188)229)155(251)208-114(56-33-41-81-186)162(258)226-148(104(16)19-3)174(270)214-111(53-30-38-78-183)154(250)222-129(91-136(192)233)168(264)221-128(90-106-47-24-21-25-48-106)167(263)220-127(89-105-45-22-20-23-46-105)166(262)212-119(61-68-133(189)230)158(254)206-110(52-29-37-77-182)153(249)218-126(88-100(10)11)169(265)223-145(101(12)13)176(272)228-84-44-59-131(228)171(267)215-121(62-69-134(190)231)175(271)227-83-43-58-130(227)170(266)213-120(66-73-144(243)244)159(255)216-122(177(273)274)63-70-135(191)232/h20-25,45-48,97-104,107-131,145-148H,17-19,26-44,49-96,179-187H2,1-16H3,(H2,188,229)(H2,189,230)(H2,190,231)(H2,191,232)(H2,192,233)(H,196,235)(H,197,245)(H,198,268)(H,199,269)(H,200,237)(H,201,236)(H,202,238)(H,203,234)(H,204,247)(H,205,252)(H,206,254)(H,207,246)(H,208,251)(H,209,253)(H,210,260)(H,211,261)(H,212,262)(H,213,266)(H,214,270)(H,215,267)(H,216,255)(H,217,248)(H,218,249)(H,219,259)(H,220,263)(H,221,264)(H,222,250)(H,223,265)(H,224,256)(H,225,257)(H,226,258)(H,239,240)(H,241,242)(H,243,244)(H,273,274)(H4,193,194,195)/t102-,103-,104-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,145-,146-,147-,148-/m0/s1
InChI KeyQXPUNNLAJZEETG-HDZBAWFTSA-N
Write a review Ask a question
My Review for CRAMP (mouse)

Required fields are marked with *

  • Basic Information
×
Ask a Question for CRAMP (mouse)

Required fields are marked with *

  • Basic Information
×
Featured Recommendations
Related Screening Libraries:
Related Small Molecules:
Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.

Featured Services
Hot Products
  • Atosiban

    Atosiban is a nonapeptide, desamino-oxytocin analogue, and a competitive vasopressin/oxytocin receptor antagonist (VOTra). Atosiban is indicated to delay imminent pre-term birth in pregnant adult women. Atosiban is useful in improving the pregnancy outcome of in vitro fertilization-embryo transfer (IVF-ET) in patients with repeated implantation failure (RIF). The pregnancy rate improved from zero to 43.7%.

    Inquiry
  • Carbetocin

    Carbetocin is a long-acting synthetic agonist analogue of human oxytocin, with antihemorrhagic and uterotonic activities. Upon administration, carbetocin targets, binds to and activates peripheral oxytocin receptors that are present on the smooth musculature of the uterus. This causes uterus contractions and prevents excessive bleeding after childbirth, particularly following Cesarean section, and may be used to decrease blood loss during hysteroscopic myomectomy.

    Inquiry
  • Teduglutide

    Teduglutide is a polypeptide consisting of 33 amino acids. It is glucagon-like peptide-2 (GLP-2) analogue that is used for the treatment of short bowel syndrome.

    Inquiry
  • Deslorelin Acetate

    Deslorelin acetate is an injectable gonadotropin releasing hormone super-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen).

    Inquiry
  • Lanreotide Acetate

    Lanreotide is a a synthetic cyclic octapeptide analogue of somatostatin. Lanreotide inhibits the secretion of growth hormone (GH) by binding to pituitary somatostatin receptors, and may inhibit the release of various other hormones, including thyroid stimulating hormone (TSH) and the gastroenteropancreatic hormones insulin, glucagon and gastrin.

    Inquiry
  • Icatibant

    Icatibant (Firazyr) is a synthetic peptidomimetic drug consisting of ten amino acids, and acts as an effective and specific antagonist of bradykinin B2 receptors. It has been approved in the EU for use in hereditary angioedema, and is under investigation for a number of other conditions in which bradykinin is thought to play a significant role.

    Inquiry
  • Antide

    Antide acetate (Ac-AA10-NH2) is an LHRH antagonist and represses LH and FSH release from the pituitary gland. It shows a high antiovulatory activity and releases negligible histamine.

    Inquiry
  • Alarelin acetate

    Alarelin acetate is a synthetic LH-RH agonist, and stimulates the release of FSH and LH from the pituitary gland. It is known for its induction of ovulation and used to treat endmometriosis.

    Inquiry
  • Carperitide

    Atrial Natriuretic Peptide (ANP) (1-28), human, porcine is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. ANP (1-28) inhibits endothelin-1 secretion in a dose-dependent way.

    Inquiry
  • Somatostatin

    Somatostatin is a tetradecapeptide which can suppress the growth hormone (GH) secretion and control the pituitary hormone secretion in human CNS.

    Inquiry
  • Atosiban

    Atosiban is a nonapeptide, desamino-oxytocin analogue, and a competitive vasopressin/oxytocin receptor antagonist (VOTra). Atosiban is indicated to delay imminent pre-term birth in pregnant adult women. Atosiban is useful in improving the pregnancy outcome of in vitro fertilization-embryo transfer (IVF-ET) in patients with repeated implantation failure (RIF). The pregnancy rate improved from zero to 43.7%.

    Inquiry
  • Carbetocin

    Carbetocin is a long-acting synthetic agonist analogue of human oxytocin, with antihemorrhagic and uterotonic activities. Upon administration, carbetocin targets, binds to and activates peripheral oxytocin receptors that are present on the smooth musculature of the uterus. This causes uterus contractions and prevents excessive bleeding after childbirth, particularly following Cesarean section, and may be used to decrease blood loss during hysteroscopic myomectomy.

    Inquiry
  • Teduglutide

    Teduglutide is a polypeptide consisting of 33 amino acids. It is glucagon-like peptide-2 (GLP-2) analogue that is used for the treatment of short bowel syndrome.

    Inquiry
  • Deslorelin Acetate

    Deslorelin acetate is an injectable gonadotropin releasing hormone super-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen).

    Inquiry
  • Lanreotide Acetate

    Lanreotide is a a synthetic cyclic octapeptide analogue of somatostatin. Lanreotide inhibits the secretion of growth hormone (GH) by binding to pituitary somatostatin receptors, and may inhibit the release of various other hormones, including thyroid stimulating hormone (TSH) and the gastroenteropancreatic hormones insulin, glucagon and gastrin.

    Inquiry
Get in touch with us

Copyright © 2025 Creative Peptides. All rights reserved.

We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy

Accept Cookies
x