CRAMP (mouse)

CRAMP (mouse) is a cathelicidin-family antimicrobial peptide used to study innate immune responses and membrane disruption mechanisms. Its amphipathic structure facilitates examination of lipid interaction and peptide insertion. Researchers analyze its sequence to understand defensin-like behavior. The molecule aids comparative immunological peptide research.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
CRAMP (mouse)(CAS 376364-36-2)

CAT No: C4801

CAS No:376364-36-2

Synonyms/Alias:376364-36-2;CHEMBL1275613;CRAMP (mouse) trifluoroacetate salt;FC109865;CATHELICIDIN RELATED ANTIMICROBIAL PEPTIDE (MOUSE);H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Gl u-Gln-OH; H-GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C178H302N50O46
M.W/Mr.
3879
Sequence
One Letter Code:GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Three Letter Code:H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH
InChI
InChI=1S/C178H302N50O46/c1-17-102(14)146(224-160(256)112(54-31-39-79-184)207-150(246)108(50-27-35-75-180)210-164(260)124(86-98(6)7)217-152(248)109(51-28-36-76-181)205-156(252)118(65-72-143(241)242)202-141(238)96-199-173(269)147(103(15)18-2)225-161(257)113(55-32-40-80-185)209-157(253)117(64-71-142(239)240)201-139(236)94-196-138(235)93-197-149(245)107(49-26-34-74-179)204-151(247)115(57-42-82-195-178(193)194)211-165(261)125(87-99(8)9)219-163(259)123(85-97(4)5)203-137(234)92-187)172(268)198-95-140(237)200-116(60-67-132(188)229)155(251)208-114(56-33-41-81-186)162(258)226-148(104(16)19-3)174(270)214-111(53-30-38-78-183)154(250)222-129(91-136(192)233)168(264)221-128(90-106-47-24-21-25-48-106)167(263)220-127(89-105-45-22-20-23-46-105)166(262)212-119(61-68-133(189)230)158(254)206-110(52-29-37-77-182)153(249)218-126(88-100(10)11)169(265)223-145(101(12)13)176(272)228-84-44-59-131(228)171(267)215-121(62-69-134(190)231)175(271)227-83-43-58-130(227)170(266)213-120(66-73-144(243)244)159(255)216-122(177(273)274)63-70-135(191)232/h20-25,45-48,97-104,107-131,145-148H,17-19,26-44,49-96,179-187H2,1-16H3,(H2,188,229)(H2,189,230)(H2,190,231)(H2,191,232)(H2,192,233)(H,196,235)(H,197,245)(H,198,268)(H,199,269)(H,200,237)(H,201,236)(H,202,238)(H,203,234)(H,204,247)(H,205,252)(H,206,254)(H,207,246)(H,208,251)(H,209,253)(H,210,260)(H,211,261)(H,212,262)(H,213,266)(H,214,270)(H,215,267)(H,216,255)(H,217,248)(H,218,249)(H,219,259)(H,220,263)(H,221,264)(H,222,250)(H,223,265)(H,224,256)(H,225,257)(H,226,258)(H,239,240)(H,241,242)(H,243,244)(H,273,274)(H4,193,194,195)/t102-,103-,104-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,145-,146-,147-,148-/m0/s1
InChI Key
QXPUNNLAJZEETG-HDZBAWFTSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Nucleic Acids SynthesisPeptide Modification ServicesPeptide CDMOPeptide Analysis ServicescGMP Peptide ServiceCustom Conjugation ServiceEpitope Mapping ServicesPeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers