1. Home
  2. Products
  3. Catalog Peptides
  4. Others Catalog Peptides
  5. CRAMP (mouse)

CRAMP (mouse)

CRAMP (mouse) is a cathelicidin-family antimicrobial peptide used to study innate immune responses and membrane disruption mechanisms. Its amphipathic structure facilitates examination of lipid interaction and peptide insertion. Researchers analyze its sequence to understand defensin-like behavior. The molecule aids comparative immunological peptide research.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
CRAMP (mouse)(CAS 376364-36-2)

CAT No: C4801

CAS No:376364-36-2

Synonyms/Alias:376364-36-2;CHEMBL1275613;CRAMP (mouse) trifluoroacetate salt;FC109865;CATHELICIDIN RELATED ANTIMICROBIAL PEPTIDE (MOUSE);H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Gl u-Gln-OH; H-GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C178H302N50O46
M.W/Mr.
3879
Sequence
One Letter Code:GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Three Letter Code:H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH
InChI
InChI=1S/C178H302N50O46/c1-17-102(14)146(224-160(256)112(54-31-39-79-184)207-150(246)108(50-27-35-75-180)210-164(260)124(86-98(6)7)217-152(248)109(51-28-36-76-181)205-156(252)118(65-72-143(241)242)202-141(238)96-199-173(269)147(103(15)18-2)225-161(257)113(55-32-40-80-185)209-157(253)117(64-71-142(239)240)201-139(236)94-196-138(235)93-197-149(245)107(49-26-34-74-179)204-151(247)115(57-42-82-195-178(193)194)211-165(261)125(87-99(8)9)219-163(259)123(85-97(4)5)203-137(234)92-187)172(268)198-95-140(237)200-116(60-67-132(188)229)155(251)208-114(56-33-41-81-186)162(258)226-148(104(16)19-3)174(270)214-111(53-30-38-78-183)154(250)222-129(91-136(192)233)168(264)221-128(90-106-47-24-21-25-48-106)167(263)220-127(89-105-45-22-20-23-46-105)166(262)212-119(61-68-133(189)230)158(254)206-110(52-29-37-77-182)153(249)218-126(88-100(10)11)169(265)223-145(101(12)13)176(272)228-84-44-59-131(228)171(267)215-121(62-69-134(190)231)175(271)227-83-43-58-130(227)170(266)213-120(66-73-144(243)244)159(255)216-122(177(273)274)63-70-135(191)232/h20-25,45-48,97-104,107-131,145-148H,17-19,26-44,49-96,179-187H2,1-16H3,(H2,188,229)(H2,189,230)(H2,190,231)(H2,191,232)(H2,192,233)(H,196,235)(H,197,245)(H,198,268)(H,199,269)(H,200,237)(H,201,236)(H,202,238)(H,203,234)(H,204,247)(H,205,252)(H,206,254)(H,207,246)(H,208,251)(H,209,253)(H,210,260)(H,211,261)(H,212,262)(H,213,266)(H,214,270)(H,215,267)(H,216,255)(H,217,248)(H,218,249)(H,219,259)(H,220,263)(H,221,264)(H,222,250)(H,223,265)(H,224,256)(H,225,257)(H,226,258)(H,239,240)(H,241,242)(H,243,244)(H,273,274)(H4,193,194,195)/t102-,103-,104-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,145-,146-,147-,148-/m0/s1
InChI Key
QXPUNNLAJZEETG-HDZBAWFTSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Nucleic Acids SynthesisCustom Conjugation ServicePeptide Analysis ServicesPeptide Synthesis ServicesPeptide CDMOEpitope Mapping ServicescGMP Peptide ServicePeptide Modification Services
Hot Products
Terlipressin

Terlipressin is a synthetic vasopressin analog that supports vascular and renal research. Purchase Terlipressin peptide from a verified supplier for liver and hemodynamic studies.

Read More Read More
Antide

Antide is a GnRH antagonist peptide used in reproductive hormone research. Buy Antide peptide powder from a reliable peptide supplier for endocrine studies.

Read More Read More
Lanreotide Acetate

Lanreotide Acetate is a somatostatin analog peptide regulating hormone secretion. Purchase Lanreotide peptide online to study tumor suppression and endocrine disorders.

Read More Read More
Thymosin β4 Acetate

Thymosin β4 Acetate promotes wound healing, tissue repair, and cell regeneration. Buy Thymosin beta 4 peptide powder for research on recovery and regenerative medicine.

Read More Read More
Icatibant

Icatibant is a potent bradykinin B2 receptor antagonist peptide for inflammation and allergy research. Buy Icatibant peptide from a reliable peptide supplier to support biomedical studies.

Read More Read More
Deslorelin

Deslorelin peptide is a potent GnRH agonist used for fertility and hormonal control. Buy Deslorelin peptide powder online for veterinary and endocrine research applications.

Read More Read More
GLP-1 (7-36) amide Acetate

GLP-1 (7-36) amide Acetate peptide enhances insulin secretion and glucose balance. Buy this research peptide for diabetes and metabolic disorder studies.

Read More Read More
Terlipressin Acetate

Terlipressin Acetate is a synthetic vasopressin analog peptide used for vascular and liver research. Buy Terlipressin peptide powder online from a trusted peptide supplier for professional studies.

Read More Read More
Fertirelin Acetate

Fertirelin Acetate is a synthetic peptide that promotes ovulation and fertility. Purchase Fertirelin research peptide for breeding and hormonal studies.

Read More Read More
Deslorelin Acetate

Deslorelin Acetate is a potent GnRH analog peptide for fertility control research. Order Deslorelin peptide from a professional peptide supplier for veterinary applications.

Read More Read More
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers