CRF(human,rat)

Corticotropin-releasing factor (CRF) (human) stimulates the synthesis and secretion of adrenocorticotropin in the anterior pituitary.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: 10-101-294

CAS No:86784-80-7

Synonyms/Alias:Corticotropin-releasing factor (human); Human CRF; Human corticotropin-releasing factor

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C208H344N60O63S2
M.W/Mr.
4758
Sequence
One Letter Code: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII  (Modifications: Ile-41 = C-terminal amide)   
Three Letter Code: Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
Purity
> 98%

Corticotropin-Releasing Factor (human, rat) is a neuropeptide belonging to the corticotropin-releasing hormone family, playing a central role in the regulation of the hypothalamic-pituitary-adrenal (HPA) axis. As a highly conserved peptide across mammalian species, it is crucial for mediating the stress response by stimulating the secretion of adrenocorticotropic hormone (ACTH) from the anterior pituitary. The human and rat forms of CRF share significant sequence homology, making this compound especially valuable for comparative studies in neuroendocrinology, behavioral neuroscience, and stress physiology. Its well-characterized structure and receptor interactions have positioned it as a fundamental tool in elucidating peptide signaling mechanisms and neuropeptide function.

Neuroendocrine research: CRF is extensively utilized to investigate the molecular and cellular mechanisms underlying HPA axis activation. By applying this peptide in in vitro and in vivo models, researchers can probe the regulatory pathways that govern ACTH release and glucocorticoid synthesis. Such studies are instrumental in advancing the understanding of homeostatic adaptation to stress and the neuroendocrine integration of external and internal stimuli. The ability to manipulate CRF levels or receptor activation provides a direct means to dissect feedback loops and hormonal crosstalk within the HPA axis.

Behavioral neuroscience: The peptide serves as a key experimental tool for exploring the neurobiological substrates of stress-related behaviors. Administration of CRF in rodent models enables the assessment of anxiety-like and depressive phenotypes, as well as the evaluation of coping strategies under various environmental challenges. By modulating CRF signaling, investigators can delineate the contributions of central and peripheral pathways to behavioral outcomes, facilitating the identification of neurochemical circuits implicated in emotional regulation and adaptive responses.

Receptor pharmacology: CRF is essential for characterizing the binding properties, signal transduction pathways, and pharmacodynamic profiles of CRF receptors (CRF1 and CRF2). Employing this peptide in receptor binding assays, second messenger studies, and functional screening platforms allows researchers to map ligand-receptor specificity, receptor distribution, and downstream effector mechanisms. Such investigations are critical for the rational design of receptor-selective modulators and for advancing the broader field of G protein-coupled receptor (GPCR) biology.

Peptide synthesis and validation: The availability of synthetic CRF with defined sequence fidelity supports the development and benchmarking of peptide synthesis methodologies. It is frequently employed as a reference standard or positive control in analytical techniques such as high-performance liquid chromatography (HPLC), mass spectrometry, and peptide mapping. These applications not only ensure the integrity and reproducibility of peptide-based studies but also aid in optimizing purification protocols and quality assessment workflows.

Signal transduction studies: CRF is a valuable reagent for dissecting intracellular signaling cascades initiated by peptide ligand binding. By stimulating cells expressing CRF receptors, scientists can monitor activation of key pathways including cyclic AMP (cAMP) production, protein kinase A (PKA) activation, and downstream gene expression responses. These experimental approaches contribute to a deeper understanding of how neuropeptide signals are transduced at the cellular level, and how these processes integrate with broader physiological and behavioral outputs.

Long-term Storage Conditions
Soluble to 1.10 mg/ml in water
Shipping Condition
Wet ice in continental US; may vary elsewhere
InChI Key
VXFVFWFSJFSXHN-FAUHKOHMSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicePeptide Modification ServicesPeptide Analysis ServicesPeptide Synthesis ServicesPeptide CDMOEpitope Mapping ServicescGMP Peptide ServicePeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers