Corticotropin-releasing factor (CRF) (human) stimulates the synthesis and secretion of adrenocorticotropin in the anterior pituitary.
CAT No: 10-101-294
CAS No: 86784-80-7
Synonyms/Alias: Corticotropin-releasing factor (human); Human CRF; Human corticotropin-releasing factor
Quick InquiryCustom Peptide SynthesisPeptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C208H344N60O63S2 |
M.W/Mr. | 4758 |
Sequence | One Letter Code: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII (Modifications: Ile-41 = C-terminal amide) Three Letter Code: Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 |
Purity | > 98% |
Long-term Storage Conditions | Soluble to 1.10 mg/ml in water |
Shipping Condition | Wet ice in continental US; may vary elsewhere |
InChI Key | VXFVFWFSJFSXHN-FAUHKOHMSA-N |
1. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
2. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
4. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
5. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.