Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | KGGPCAKKPCCGPLGHYKVDCSTIPDYPCCSKYGFCGSGPQYCG |
Activity | Antimicrobial |
Host Chemicals | Cycas revoluta |
Length | 44 |
2. Cationic cell-penetrating peptides are potent furin inhibitors
4. Implications of ligand-receptor binding kinetics on GLP-1R signalling
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.