Home > Product > Antimicrobial Peptides > Cycloviolin-A

Antimicrobial Peptides

Cycloviolin-A

Price Inquiry
CAT#
AF2042
Sequence
GVIPCGESCVFIPCISAAIGCSCKNKVCYRN
Host Chemicals
Leonia cymosa
Length
31
Activity
Antiviral
SwissProt ID
P84637

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.