Home > Product > Antimicrobial Peptides > Cycloviolin-D

Antimicrobial Peptides

Cycloviolin-D

Price Inquiry
CAT#
AF1899
Sequence
GFPCGESCVFIPCISAAIGCSCKNKVCYRN
Host Chemicals
Leonia cymosa
Length
30
Activity
Antiviral
SwissProt ID
P84640

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.