Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GFPCGESCVFIPCISAAIGCSCKNKVCYRN |
Activity | Antiviral |
Host Chemicals | Leonia cymosa |
Length | 30 |
SwissProt ID | P84640 |
4. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
5. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.