Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C208H345N61O54S |
M.W/Mr. | 4596.41 |
Sequence | One Letter Code:CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES Three Letter Code:Cys-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.