[Cys1] Inter-alpha-Trypsin Inhibitor Heavy Chain 4, ITIH4 (657-687), C-terminal fragment 1, H4CT

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	S06002
M.W/Mr.	3376.9
Sequence	CMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF

CAT#	Product Name	Inquiry
X12240	PM_3481367	Inquiry
X06491	PM_1476664	Inquiry
X03127	PM_10688972	Inquiry
X20560	UP_Q58T42	Inquiry
X11295	PM_2527238	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of thymosin β15 in metastatic prostate cancer diagnosis

As a small actin-binding protein upregulated in highly metastatic prostate cancer cells, thymosin β15 (Tβ15) has ...

Orexin Peptides

Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...

Obtustatin: a potent selective α1β1 inhibitor

Obtustatin isolated from the venom of the Vipera lebetina obtusa viper is a highly potent integrin α1β1 inhibito ...

Ziconotide: Use in the treatment of pain

Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...

Calcitonin

Discovery and Structure Calcitonin, also called thyrocalcitonin, a protein hormone synthesized and secreted in humans and oth ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: