Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 3376.9 |
Sequence | CMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
Length | 31 |
1. Emu oil in combination with other active ingredients for treating skin imperfections
4. High fat diet and GLP-1 drugs induce pancreatic injury in mice
5. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
Required fields are marked with *
×Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.