CAT# | AF2389 |
Sequence | SQWVTPNDSLCAAHCIARRYRGGYCNGKRVCVCR |
Activity | Antibacterial |
Host Chemicals | Anopheles gambiae | Length | 34 | SwissProt ID | Q17027 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1855 | Def-Acaa | Inquiry | ||
AF1588 | Dermaseptin-like peptide | Inquiry | ||
AF2973 | Antihypertensive protein BDS-1 | Inquiry | ||
AF1274 | Brevinin-1SPd | Inquiry | ||
AF393 | Frenatin-2 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
3. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
4. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
5. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Ornithoctonus huwena, Chinese tarantula, is one of the most venomous spiders in China, and its venom can kill in ...
Gonadorelin is a synthetic GnRH, a peptide compound, and a decapeptide whose structure is exactly the same as th ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...
AdTx1, also called as ρ-Da1a, is a polypeptide of 65 amino acids stabilized by four disulfide bonds, which has a ...
As a small actin-binding protein upregulated in highly metastatic prostate cancer cells, thymosin β15 (Tβ15) has ...