Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | SQWVTPNDSLCAAHCLVKGYRGGYCKNKICHCR |
Activity | Antibacterial |
Host Chemicals | Anopheles gambiae |
Length | 33 |
SwissProt ID | Q17027 |
1. Cationic cell-penetrating peptides are potent furin inhibitors
2. The spatiotemporal control of signalling and trafficking of the GLP-1R
5. High fat diet and GLP-1 drugs induce pancreatic injury in mice
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.