Keywords Search Google Search Search

Def-Bbb

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2312
Sequence	SQWVTPNDSLCAAHCLVKGYRGGYCKNKICHCR
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF761	Mersacidin	Inquiry
AF1655	Violacin A	Inquiry
AF314	Temporin-1Gd	Inquiry
AF1841	Cc-CATH3	Inquiry
AF1428	Maximin 31	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

What is PT-141?

PT-141, also called as Bremelanotide, is a derivative for Melanotan 2 (M2). Unlike M2, PT-141 lacks C-terminal a ...

Enhanced Binding and Antagonism of Camstatin

Camstatin is a similar PEP-19 analogue with enhanced calmodulin binding and antagonism. It is a functional 25- ...

Function of lysipressin in diabetes insipidus

Figure 1. Chemical structure of lysipressinLysipressin ([Lys8]-vasopressin) has been identified in the North Ame ...

An undecapeptite of mollusk origin-Eledoisin

Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...

Function of phosphoramidon as an endothelin converting enzyme inhibitor

Phosphoramidon is a kind of thermolysin inhibitor isolated from a culture filtrate of streptomyces. It has prove ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Anopheles gambiae
Length	33
SwissProt ID	Q17027