Home > Product > Antimicrobial Peptides > Defensin C

Antimicrobial Peptides

Defensin C

Price Inquiry
CAT#
AF2303
Sequence
SKWFTPNHAGCAAHCIFLGNRGGRCVGTVCHCR
Host Chemicals
Rhodnius prolixus
Length
33
Activity
Antimicrobial
SwissProt ID
Q86MY1

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.