Defensin HNP-1 (Human)

Human defensin-1 (HNP-1) is a peptide possessing both broad antimicrobial (both Gram-positive and Gram-negative bacteria) and cytotoxic activities. HNP-1 reduces adenoviral infection by more than 95%.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	10-101-279
CAS	99287-08-8
Synonyms/Alias	Defensin-1, human; HNP-1
M.F/Formula	C150H228N44O38S6
M.W/Mr.	3442.03
Sequence	One Letter Code: [CCCCCC]ACYCRIPACIAGERRYGTCIYQGRLWAFCC Three Letter Code: [Cys2-Cys30, Cys4-Cys19, Cys9-Cys29] Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys
Purity	>95%

CAT#	Product Name	Inquiry
10-101-70	Argipressin	Inquiry
P6924	Teriparatide	Inquiry
Z10-101-165	Hygromycin B	Inquiry
10-101-325	Semaglutide	Inquiry
10-101-41	Splenopentin Acetate	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Storage	Store at -20°C.
Shipping Condition	Shipped at room temperature