CAT# | D06008 |
Sequence | QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYVPC |
Length | 51 | Modifications | Disulfide bonds(4) |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
D01003 | α-Defensin 6 | Inquiry | ||
D06003 | Defensin-like protein 2 | Inquiry | ||
D06004 | Defensin-like protein 4 | Inquiry | ||
D01004 | Defensin HNP-3 (human) | Inquiry | ||
D06011 | Defensin-like protein 13 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
3. TMEM16F and dynamins control expansive plasma membrane reservoirs
4. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
5. Myotropic activity of allatostatins in tenebrionid beetles
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Pramlintide is a synthetic analogue of pancreatic amyloid polypeptide. Pancreatic amyloid polypeptide is a polyp ...
Figure 1. Chemical structure of pentagastrinPentagastrin, known as peptavlon, is a synthetic pentapeptide that p ...
Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...
Teicoplanin is a glycopeptide antibiotic developed after vancomycin for the treatment of Gram-positive (G+) cocc ...
Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...