Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYVPC |
Length | 51 |
Modifications | Disulfide bonds(4) |
3. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
5. The spatiotemporal control of signalling and trafficking of the GLP-1R
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.