Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | RDCTSQSHKFVGLCLSDRNCASVCLTEYFTGGKCDHRRCVCTKGC |
Activity | Antimicrobial |
Host Chemicals | Triticum kiharae |
Length | 45 |
SwissProt ID | P84971 |
3. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
5. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.