Home > Product > Catalog Peptides > Others > Delta-hexatoxin-Hv1a

Others

Delta-hexatoxin-Hv1a

Price Inquiry
CAT#
A38001
Sequence
CAKKRNWCGKTEDCCCPMKCVYAWYNEQGSCQSTISALWKKC
Modifications
Disulfide bond(4)
Length
42

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.