Home > Product > Antimicrobial Peptides > Dolabellanin-B2

Antimicrobial Peptides

Dolabellanin-B2

Price Inquiry
CAT#
AF2294
Sequence
SHQDCYEALHKCMASHSKPFSCSMKFHMCLQQQ
Host Chemicals
Dolabella auricularia
Length
33
Activity
Antibacterial, Antifungal
SwissProt ID
P83376

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.