CAT# | AF2294 |
Sequence | SHQDCYEALHKCMASHSKPFSCSMKFHMCLQQQ |
Activity | Antibacterial, Antifungal |
Host Chemicals | Dolabella auricularia | Length | 33 | SwissProt ID | P83376 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF271 | Temporin 1Pra | Inquiry | ||
AF1798 | Viba17 | Inquiry | ||
AF970 | Nigrocin-OG13 | Inquiry | ||
AF2583 | Ir-Def1 | Inquiry | ||
AF2005 | Palustrin-2a | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Abarelix, sold under the brand name Plenaxis, is a synthetic decapeptide and Gonadotropin-releasing hormone (GnR ...
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...
Topotecan (TPT) is a water-soluble, semi-synthetic camptothecin derivative developed by Smithkline Beecham, USA. ...
Astressin 2B is a peptidic antagonist to CRF2 (corticotrophin-releasing factor 2) receptor with structure of cyc ...