CAT# | AF2920 |
Sequence | ADTLACRQSHQSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS |
Activity | Antibacterial |
Host Chemicals | Anas platyrhynchos | Length | 42 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF3124 | Hainanensin-4 antimicrobial peptide precursor | Inquiry | ||
AF1447 | Caerin-1.10 | Inquiry | ||
AF1125 | Alyteserin-1a | Inquiry | ||
AF1921 | Cycloviolacin-O2 | Inquiry | ||
AF1976 | Centrocin 2 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...
TC 14012 is a serum-stable derivative of the peptidomimetic T140, which is a cyclic peptide with the structure o ...
PBP 10 (RhoB-Glu-Arg-Leu-Phe-Glc-Val-Lys-Glc-Arg-Arg) is a 10-aa-long rhodamine-linked and membrane-permeable pe ...
Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...
Ornithoctonus huwena, Chinese tarantula, is one of the most venomous spiders in China, and its venom can kill in ...