Keywords Search Google Search Search

EcAMP1

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2631
Sequence	GSGRGSCRSQCMRRHEDEPWRVQECVSQCRRRRGGGD
Activity	Antifungal

CAT#	Product Name	Inquiry
AF2762	WAMP-2	Inquiry
AF2912	Arasin-likeSp	Inquiry
AF3184	Esculentin-1-OR3	Inquiry
AF283	Temporin-La	Inquiry
AF233	Temporin-1SPb	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of resveratrol in atherosclerosis

Resveratrol is also known as stilbene III. Its chemical name is (E)-3,5,4-trihydroxystilbene. It is a non-fla ...

KAI-1678: A novel PKC-epsilon inhibitor

KAI-1678, a synthetic 21-amino acid, is a novel PKC-epsilon (ε-PKC) inhibitor with a molecular weight of 2541 Da ...

What is PT-141?

PT-141, also called as Bremelanotide, is a derivative for Melanotan 2 (M2). Unlike M2, PT-141 lacks C-terminal a ...

APETx2, A Kind of ASIC3 Channel Blocker

APETx2, a 42 amino-acid peptide toxin isolated from sea anemone Anthopleura elegantissima, is a kind of acid-s ...

Palmitoyl pentapeptide-4

An overview of Palmitoyl pentapeptide-4 The potential of topical peptides to improve aging skin has been widely discussed in ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Echinochloa crus-galli
Length	37
SwissProt ID	P86698