Echistatin, α1 isoform

Effective irreversible antagonist of αVβ3 integrin that disrupts attachment of osteoclasts to bone and inhibits bone reabsorption (IC50 = 0.1 nM).

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R0941

CAS No:154303-05-6

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C217H341N71O74S9
M.W/Mr.
5417.1
Sequence
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT(Disulfide bridge between Cys2 and Cys11, Cys7 and Cys32, Cys8 and Cys37, Cys20 and Cys39)
Labeling Target
αVβ3 integrin
Appearance
White lyophilised solid
Purity
>98%
Activity
Antagonist

Echistatin, α1 isoform is a disintegrin peptide originally isolated from the venom of the saw-scaled viper Echis carinatus, recognized for its high-affinity interaction with integrin receptors on cell surfaces. As a member of the disintegrin family, this peptide is characterized by its RGD (Arg-Gly-Asp) motif, which enables potent inhibition of integrin-mediated cell adhesion. Its unique structural properties and specificity make it a valuable molecular tool in the study of cell-extracellular matrix interactions, signal transduction, and the regulation of cellular motility and adhesion. Echistatin, α1 isoform is widely employed in biochemical and cell biology research to dissect integrin function and to elucidate mechanisms underlying cell migration, angiogenesis, and related physiological and pathological processes.

Integrin receptor studies: Echistatin, α1 isoform serves as a selective inhibitor of integrin receptors, particularly those containing the β1 and β3 subunits, such as αIIbβ3, αvβ3, and α5β1. Its capacity to bind these integrins with high affinity allows researchers to probe the molecular basis of integrin-ligand interactions in vitro. By competitively blocking the interaction between integrins and their natural ligands, the peptide enables detailed investigation of cell adhesion, spreading, and signaling pathways mediated by these receptors, providing insights into the regulation of cellular attachment and detachment.

Cell migration and invasion assays: The peptide is extensively utilized in studies of cell motility, including migration and invasion assays. By disrupting integrin-dependent adhesion, echistatin, α1 isoform allows for the analysis of how integrin engagement influences cytoskeletal dynamics and directional movement. Its application in transwell migration, wound healing, and three-dimensional invasion models has advanced understanding of processes such as tumor cell dissemination, tissue remodeling, and immune cell trafficking.

Angiogenesis research: Echistatin, α1 isoform is a powerful tool in the investigation of angiogenesis, the formation of new blood vessels from pre-existing vasculature. By inhibiting integrins involved in endothelial cell adhesion and migration, it enables researchers to dissect the role of integrin signaling in neovascularization. Studies employing this peptide have contributed to elucidating the molecular mechanisms that govern endothelial cell behavior during vascular development and pathological angiogenesis, such as in tumor progression or ocular diseases.

Platelet aggregation assays: The ability of echistatin, α1 isoform to bind the platelet integrin αIIbβ3 makes it highly relevant for studies of platelet function and thrombosis. In platelet aggregation assays, the peptide is used to inhibit fibrinogen binding and subsequent platelet-platelet interactions, facilitating research into the pathways regulating hemostasis, thrombosis, and platelet-mediated inflammatory responses. Its use aids in distinguishing integrin-dependent mechanisms from other pathways involved in platelet activation.

Structural and biophysical analysis: Echistatin, α1 isoform is also employed in structural biology and biophysical studies aimed at elucidating integrin-ligand recognition at the atomic level. The peptide's well-defined RGD motif and disulfide-rich structure make it an excellent model for crystallography, NMR spectroscopy, and surface plasmon resonance experiments. These applications have advanced the understanding of conformational changes in integrins upon ligand binding and informed the rational design of synthetic integrin antagonists for research use.

InChI
InChI=1S/C217H341N71O74S9/c1-11-102(4)166-208(356)278-143-97-370-371-99-145(212(360)288-71-32-46-148(288)206(354)260-121(43-28-67-239-217(233)234)183(331)271-136(79-152(226)296)211(359)287-70-31-47-149(287)207(355)270-128(76-110-85-235-100-245-110)190(338)251-113(35-15-20-59-218)174(322)243-89-156(300)285-68-29-44-146(285)204(352)247-104(6)171(319)284-169(107(9)292)213(361)362)280-196(344)135(84-165(316)317)269-202(350)144-98-369-366-94-140-199(347)256-120(42-27-66-238-216(231)232)182(330)265-130(78-151(225)295)191(339)275-139(198(346)255-118(39-19-24-63-222)181(329)262-126(74-108-33-13-12-14-34-108)188(336)261-125(73-101(2)3)187(335)253-116(37-17-22-61-220)180(328)257-122(53-56-159(304)305)175(323)241-88-155(299)281-167(105(7)290)210(358)282-166)93-365-364-92-138(273-172(320)112(223)52-55-158(302)303)197(345)258-123(54-57-160(306)307)184(332)272-137(91-289)177(325)244-90-157(301)286-69-30-45-147(286)205(353)277-142(203(351)276-140)96-368-367-95-141(201(349)264-129(77-150(224)294)176(324)242-86-153(297)248-115(36-16-21-60-219)186(334)283-168(106(8)291)209(357)279-144)274-189(337)127(75-109-48-50-111(293)51-49-109)263-194(342)134(83-164(314)315)268-195(343)133(82-163(312)313)266-185(333)124(58-72-363-10)259-193(341)132(81-162(310)311)267-192(340)131(80-161(308)309)249-154(298)87-240-173(321)114(40-25-64-236-214(227)228)250-170(318)103(5)246-178(326)119(41-26-65-237-215(229)230)252-179(327)117(254-200(143)348)38-18-23-62-221/h12-14,33-34,48-51,85,100-107,112-149,166-169,289-293H,11,15-32,35-47,52-84,86-99,218-223H2,1-10H3,(H2,224,294)(H2,225,295)(H2,226,296)(H,235,245)(H,240,321)(H,241,323)(H,242,324)(H,243,322)(H,244,325)(H,246,326)(H,247,352)(H,248,297)(H,249,298)(H,250,318)(H,251,338)(H,252,327)(H,253,335)(H,254,348)(H,255,346)(H,256,347)(H,257,328)(H,258,345)(H,259,341)(H,260,354)(H,261,336)(H,262,329)(H,263,342)(H,264,349)(H,265,330)(H,266,333)(H,267,340)(H,268,343)(H,269,350)(H,270,355)(H,271,331)(H,272,332)(H,273,320)(H,274,337)(H,275,339)(H,276,351)(H,277,353)(H,278,356)(H,279,357)(H,280,344)(H,281,299)(H,282,358)(H,283,334)(H,284,319)(H,302,303)(H,304,305)(H,306,307)(H,308,309)(H,310,311)(H,312,313)(H,314,315)(H,316,317)(H,361,362)(H4,227,228,236)(H4,229,230,237)(H4,231,232,238)(H4,233,234,239)
InChI Key
KZMZKUVIDVBQGX-UHFFFAOYSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesPeptide Modification ServicescGMP Peptide ServicePeptide Nucleic Acids SynthesisPeptide CDMOCustom Conjugation ServiceEpitope Mapping ServicesPeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers