Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ |
Length | 57 |
Modifications | Disulfide bond(4) |
3. High fat diet and GLP-1 drugs induce pancreatic injury in mice
4. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
5. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.