Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | ESVFSKIGNAVGPAAYWILKGLGNMSDVNQADRINRKKH |
Activity | Antibacterial |
Host Chemicals | Enterococcus faecalis BFE 1071 |
Length | 39 |
3. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
4. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.