CAT# | AF2394 |
Sequence | TMKKSLLFFFFLGTISLSLCEQERGADEDDGVEE |
Activity | Antimicrobial |
Host Chemicals | Hylarana spinulosa | Length | 34 | SwissProt ID | E7EKH9 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF552 | Bombolitin V | Inquiry | ||
AF056 | Theta defensin subunit A | Inquiry | ||
AF2035 | Kalata-B8 | Inquiry | ||
AF1562 | Defensin-related cryptdin-related sequence 7 | Inquiry | ||
AF194 | Temporin-1Ca | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Endothelin-1 (ET-1) is a vasoactive peptide containing 21 amino acids, which was first isolated from the culture ...
C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...
Background Aclerastide, one angiotensin receptor agonist, is the active ingredient of DSC127 and its general structure is sho ...
The peptide Difopein, designed, isolated and identified by Haian Fu, is a high affinity inhibitor of 14-3-3 pro ...
What is palmitoyl tripeptide-38? Palmitoyl tripeptide-38 (PT-38), named MATRIXYL synthe'6 and Volulip, a cosmetic peptide or ...