Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | GLFTLIKGAVKMIGKTVAKEAGKTGLELMACKVTNQC |
Activity | Antibacterial |
Host Chemicals | Odorrana schmackeri |
Length | 37 |
SwissProt ID | Q1MU20 |
2. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
4. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.