Home > Product > Antimicrobial Peptides > Esculentin-2-RA2 peptide precursor

Antimicrobial Peptides

Esculentin-2-RA2 peptide precursor

Price Inquiry
CAT#
AF2505
Sequence
IFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQC
Host Chemicals
Odorrana andersonii (golden crossband frog)
Length
36
Activity
Antimicrobial
SwissProt ID
E3SYM6

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.