Keywords Search Google Search Search

Esculentin-2-RA2 peptide precursor

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2505
Sequence	IFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQC
Activity	Antimicrobial

CAT#	Product Name	Inquiry
AF228	Temporin-1CSc	Inquiry
AF1187	Brevinin-1V	Inquiry
AF2544	Neutrophil beta-defensin 4	Inquiry
AF768	Chrysophsin-3	Inquiry
AF2999	Putative antimicrobial peptide	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Palmitoyl Tripeptide-5

of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...

Function of pramlintide in diabetes

Pramlintide is a synthetic analogue of pancreatic amyloid polypeptide. Pancreatic amyloid polypeptide is a polyp ...

Function of teriparatide in the treatment of osteoporosis

Teriparatide is a human parathyroid hormone analog with the same structure as the N-terminal 34 amino acid seque ...

Function of Abarelix in Advanced Prostate Cancer

Abarelix, sold under the brand name Plenaxis, is a synthetic decapeptide and Gonadotropin-releasing hormone (GnR ...

The Function of Dipeptide-4 in Human Skin

An of Dipeptide A Peptide is a constituent fragment in the structure of a protein and is linked by an amide bond ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Odorrana andersonii (golden crossband frog)
Length	36
SwissProt ID	E3SYM6