Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 3558.0 |
Sequence | TSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSNH3 |
Length | 36 |
2. High fat diet and GLP-1 drugs induce pancreatic injury in mice
4. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.