Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCK |
Activity | Antibacterial |
Host Chemicals | Fagopyrum esculentum |
Length | 40 |
1. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
2. Myotropic activity of allatostatins in tenebrionid beetles
3. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
5. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.