Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | LLGRCKVKSNRFHGPCLTDTHCSTVCRGEGYKGGDCHGLRRRCMCLC |
Activity | Gram+ & Gram-, |
Host Chemicals | Broad bean, Vicia faba |
Length | 47 |
SwissProt ID | SwissProt ID: P81456 |
1. High fat diet and GLP-1 drugs induce pancreatic injury in mice
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.