CAT# | AF2766 |
Sequence | FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
Activity | Antibacterial |
Host Chemicals | Homo sapiens | Length | 39 | SwissProt ID | P49913 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1889 | Brevinin-2SN4 | Inquiry | ||
AF2695 | Beta-defensin133 | Inquiry | ||
AF869 | Nigroain-B-SN1 antimicrobial peptide precursor | Inquiry | ||
AF673 | Nigroain-C2 | Inquiry | ||
AF332 | Polybia-MP-II | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Catestain, a 21 amino acid fragment of chromogranin A (CgA), is divided into human CgA352-372 and bovine CgA344- ...
Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...
Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino aci ...
(d(CH2)51,Tyr(Me)2,Arg8)-vasopressin, a kind of vasopressin, is a prohormone in neurons in the hypothalamus. Vas ...
Acetyl pepstatin, nature products of yeast fermentation, is general inhibitors of the family of aspartic proteas ...