Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
Activity | Antibacterial |
Host Chemicals | Homo sapiens |
Length | 39 |
SwissProt ID | P49913 |
3. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
4. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.