Keywords Search Google Search Search

Fibronectin Binding Protein Peptide, D3 Peptide

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	F02041
M.W/Mr.	4310.6
Sequence	FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV

CAT#	Product Name	Inquiry
F02032	Fibronectin (1946-1960), FN-C/H2	Inquiry
F02016	Fibronectin (1951-1960), FN-C/H2-CO	Inquiry
F02031	[Tyr15] Fibrinopeptide B, human	Inquiry
F02021	V14 Peptide	Inquiry
F02002	Gamma-Fibrinogen (377-395), scrambled	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of PM102 for the reversal of heparin anticoagulation

PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...

Function of P11 in a protein chip system

P11 (HSDVHK) is a novel peptide ligand containing a PDZ-binding motif (Ser-Asp-Val) with high affinity to integr ...

Desmopressin

Basic information Desmopressin is a synthetic analogue of the antidiuretic hormone vasopressin used in the treatment of centr ...

Purotoxin 1, a highly selective blocker of Р2Х3 receptors

Purotoxin 1, a component from the venom of Geolycosa spiders, exerts selective inhibitory action on P2X3 recep ...

Function of dulaglutide in type 2 diabetes

Dulaglutide, sold under the brand name Trulicity, is a GLP-1 receptor agonist which is a class of medications th ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: