Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | FTMKKSLLLLFFLGTINLSLCEKERNAEEEKRDGDDETDVEVQK |
Activity | Antimicrobial |
Host Chemicals | Rana nigrovittata |
Length | 44 |
SwissProt ID | C0ILJ2 |
2. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
4. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
5. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.