Galanin (1-13)-Spantide I

Galanin (1-13)-Spantide I merges galanin’s N-terminal region with a tachykinin-related antagonist sequence to investigate ligand diversification strategies. Its design enables the study of multi-receptor modulation and binding competition. Researchers use it to analyze sequence-driven conformational tuning. The peptide contributes to understanding cross-pathway neuropeptide regulation.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: G01011

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C138H199N35O30
M.W/Mr.
2828.3
Sequence
GWTLNSAGYLLGPDRPKPQQDWFDWLL-NH2
Length
27

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicesPeptide Modification ServicesPeptide Analysis ServicesPeptide CDMOEpitope Mapping ServicescGMP Peptide ServiceCustom Conjugation ServicePeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers