Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GRKSDCFRKNGFCAFLKCPYLTLISGKCSRFHLCCKRIW |
Activity | Antibacterial, Antifungal |
Host Chemicals | Gallus gallus |
Length | 39 |
SwissProt ID | P46157 |
1. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
4. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.