Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | SPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSCCVRNRWA |
Activity | Antibacterial |
Host Chemicals | Gallus gallus |
Length | 42 |
SwissProt ID | Q6QLR3 |
1. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
2. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
3. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
4. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
5. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.