Gastric Inhibitory Polypeptide (1-30), porcine

Gastric Inhibitory Polypeptide (1-30), porcine captures the N-terminal active core of porcine GIP. The fragment retains residues central to receptor engagement and signaling initiation. Researchers employ it to evaluate truncation effects on folding, affinity, and proteolytic stability. Its sequence is useful in comparative porcine-human GIP studies.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: G02004

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C162H244N40O48S1
M.W/Mr.
3552.1
Sequence
YAEGTFISDYSIAMDKIRQQDFVNWLLAQK
Length
30

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesPeptide Synthesis ServicesCustom Conjugation ServicecGMP Peptide ServicePeptide CDMOPeptide Nucleic Acids SynthesisEpitope Mapping ServicesPeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers