Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C162H244N40O48S1 |
M.W/Mr. | 3552.1 |
Sequence | YAEGTFISDYSIAMDKIRQQDFVNWLLAQK |
Length | 30 |
2. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
4. Emu oil in combination with other active ingredients for treating skin imperfections
Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.