GIP (3-42), human

Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

CAT No: G02006

Synonyms/Alias: GIP (3-42), human;1802086-25-4;G13559;

Quick InquiryCustom Peptide Synthesis

Peptide Library Construction and Screening

Powerful screening tools in biological and chemical research

M.F/FormulaC199H298N54O57S
M.W/Mr.4391
SequenceOne Letter Code:EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHN
Three Letter Code:H-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-al
Length40
InChIInChI=1S/C199H298N54O57S/c1-17-102(10)162(253-194(305)147(96-256)247-181(292)133(76-110-53-55-116(258)56-54-110)234-189(300)145(87-160(275)276)243-193(304)146(95-255)248-198(309)164(104(12)19-3)252-192(303)135(75-109-42-24-21-25-43-109)244-199(310)165(107(15)257)249-155(266)93-216-168(279)119(205)57-64-156(267)268)196(307)221-106(14)167(278)225-130(65-71-311-16)176(287)241-142(84-157(269)270)187(298)229-126(52-34-39-70-204)177(288)251-163(103(11)18-2)197(308)245-139(80-114-91-213-98-219-114)184(295)231-128(59-62-149(207)260)174(285)230-129(60-63-150(208)261)175(286)240-143(85-158(271)272)188(299)235-134(74-108-40-22-20-23-41-108)191(302)250-161(101(8)9)195(306)246-141(83-153(211)264)186(297)236-137(78-112-89-215-121-47-29-27-45-118(112)121)183(294)233-132(73-100(6)7)180(291)232-131(72-99(4)5)178(289)220-105(13)166(277)224-127(58-61-148(206)259)173(284)226-122(48-30-35-66-200)169(280)217-92-154(265)223-123(49-31-36-67-201)170(281)227-124(50-32-37-68-202)172(283)239-140(82-152(210)263)185(296)242-144(86-159(273)274)190(301)237-136(77-111-88-214-120-46-28-26-44-117(111)120)182(293)228-125(51-33-38-69-203)171(282)238-138(79-113-90-212-97-218-113)179(290)222-115(94-254)81-151(209)262/h20-29,40-47,53-56,88-91,94,97-107,115,119,122-147,161-165,214-215,255-258H,17-19,30-39,48-52,57-87,92-93,95-96,200-205H2,1-16H3,(H2,206,259)(H2,207,260)(H2,208,261)(H2,209,262)(H2,210,263)(H2,211,264)(H,212,218)(H,213,219)(H,216,279)(H,217,280)(H,220,289)(H,221,307)(H,222,290)(H,223,265)(H,224,277)(H,225,278)(H,226,284)(H,227,281)(H,228,293)(H,229,298)(H,230,285)(H,231,295)(H,232,291)(H,233,294)(H,234,300)(H,235,299)(H,236,297)(H,237,301)(H,238,282)(H,239,283)(H,240,286)(H,241,287)(H,242,296)(H,243,304)(H,244,310)(H,245,308)(H,246,306)(H,247,292)(H,248,309)(H,249,266)(H,250,302)(H,251,288)(H,252,303)(H,253,305)(H,267,268)(H,269,270)(H,271,272)(H,273,274)(H,275,276)/t102-,103-,104-,105-,106-,107+,115-,119-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,161-,162-,163-,164-,165-/m0/s1
InChI KeyQYLDDJIZEWSFPS-YUZGIZTPSA-N
Write a review Ask a question
My Review for GIP (3-42), human

Required fields are marked with *

  • Basic Information
×
Ask a Question for GIP (3-42), human

Required fields are marked with *

  • Basic Information
×
Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.

Featured Services
Hot Products
  • Aviptadil Acetate

    Aviptadil, also known as vasoactive intestinal polypeptide (VIP), is a 28 amino acid neuropeptide that belongs to the glucagon-growth hormone-releasing factor secretion superfamily. Aviptadil acts as a potent systemic vasodilator and bronchodilator. It inhibits the proliferation of vascular and bronchial smooth muscle cells and decreases platelet aggregation. These biological effects are mediated by specific VIP receptors.

    Inquiry
  • GLP-1 (7-37) Acetate

    Glucagon-like peptide-1 (GLP-1) is an incretin derived from the transcription product of the proglucagon gene. The major source of GLP-1 in the body is the intestinal L cell that secretes GLP-2 as a gut hormone.

    Inquiry
  • Atosiban

    Atosiban is a nonapeptide, desamino-oxytocin analogue, and a competitive vasopressin/oxytocin receptor antagonist (VOTra). Atosiban is indicated to delay imminent pre-term birth in pregnant adult women. Atosiban is useful in improving the pregnancy outcome of in vitro fertilization-embryo transfer (IVF-ET) in patients with repeated implantation failure (RIF). The pregnancy rate improved from zero to 43.7%.

    Inquiry
  • Teduglutide

    Teduglutide is a polypeptide consisting of 33 amino acids. It is glucagon-like peptide-2 (GLP-2) analogue that is used for the treatment of short bowel syndrome.

    Inquiry
  • Fertirelin Acetate

    Fertirelin acetate is a potent LHRH agonist. After a transient increase, continuous administration results in downregulation of LH and FSH levels followed by a suppression of ovarian and testicular steroid biosynthesis.

    Inquiry
  • Deslorelin Acetate

    Deslorelin acetate is an injectable gonadotropin releasing hormone super-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen).

    Inquiry
  • Angiotensin II

    Angiotensin II human (Angiotensin II) is a vasoconstrictor that mainly acts on the AT1 receptor. Angiotensin II human stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions. Angiotensin II human induces growth of vascular smooth muscle cells, increases collagen type I and III synthesis in fibroblasts, leading to thickening of the vascular wall and myocardium, and fibrosis. Angiotensin II human also induces apoptosis.

    Inquiry
  • Terlipressin

    Terlipressin is a synthetic triglycyllysine derivative of vasopressin with vasoconstrictive, antihemorrhagic, and antidiuretic properties. Upon intravenous administration, terlipressin, an inactive prodrug, is biotransformed to its active moiety, lysine vasopressin (LVP), a nonselective vasopressin analogue with affinity for vasopressin receptors V1 (V1a), V2 and V3 (V1b). As a V1 agonist, terlipressin increases systemic vascular resistance, particularly in the splanchnic area, resulting in a decrease of portal pressure. V1 binding also promotes platelet aggregation and glycogenolysis, while V3 binding induces adrenocorticotropic hormone (ACTH) secretion. Compared to vasopressin, terlipressin has a minimal effect on V2 receptors, which are responsible for promotion of water reabsorption in the collecting ducts of the kidney via stimulation of cyclic AMP production.

    Inquiry
  • Gonadorelin Acetate

    Gonadorelin is a trophic peptide hormone responsible for the release of follicle-stimulating hormone (FSH) and luteinizing hormone (LH) from the anterior pituitary. GnRH is synthesized and released from GnRH neurons within the hypothalamus. The peptide belongs to gonadotropin-releasing hormone family. It constitutes the initial step in the hypothalamic–pituitary–gonadal axis.

    Inquiry
  • Alarelin acetate

    Alarelin acetate is a synthetic LH-RH agonist, and stimulates the release of FSH and LH from the pituitary gland. It is known for its induction of ovulation and used to treat endmometriosis.

    Inquiry
Get in touch with us

Copyright © 2025 Creative Peptides. All rights reserved.