Gastric Inhibitory Peptide (GIP), human is thought to act as an inhibitor of gastric functions.
CAT# | R1092 |
Chemical Structure | |
CAS | 100040-31-1 |
M.F/Formula | C226H338N60O66S |
M.W/Mr. | 4983.58 |
Sequence | One Letter Code: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ Three Letter Code: Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln |
Appearance | White lyophilized solid |
Biological Activity | Potent insulinotropic hormone synthesized by duodenal K-cells. High affinity GIP receptor agonist (EC50 = 0.81 nM) that inhibits gastric acid secretion and stimulates pancreatic insulin release in response to glucose. Also affects lipid metabolism and displays mitogenic and antiapoptotic effects in pancreatic β-cells. |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...
UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...
The pancreatic polypeptide (PP) family includes three endogenous peptides: PP, peptides-neuropeptide Y (NYP) and ...
Overview of the kinin system Kinins are peptide hormones that are formed as part of the kinin-kallikrein system (KKS). kinin ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...