Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 4513.1 |
Sequence | DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA |
Length | 42 |
1. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
3. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
5. Myotropic activity of allatostatins in tenebrionid beetles
Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.