GLP-1(7-36) Acetate

GLP-1(7-36) Acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
GLP-1(7-36) Acetate(CAS 1119517-19-9)

CAT No: 10-101-293

CAS No:1119517-19-9

Synonyms/Alias:GLP-1(7-36) Acetate;1119517-19-9;DA-63787;F85454;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C151H230N40O47
M.W/Mr.
3357.7
Sequence
One Letter Code:HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Three Letter Code:H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2.CH3CO2H
Purity
> 98%

GLP-1(7-36) Acetate, also known as Glucagon-Like Peptide-1 (7-36) Acetate, is a synthetic peptide fragment corresponding to the active form of the incretin hormone GLP-1. This compound is widely recognized for its ability to mimic the physiological effects of endogenous GLP-1, a key regulator in metabolic and endocrine pathways. As a stable and highly bioactive peptide, GLP-1(7-36) Acetate is extensively utilized in laboratory and preclinical research to investigate mechanisms associated with glucose metabolism, insulin secretion, and appetite regulation. Its well-characterized structure and receptor specificity make it an invaluable tool in elucidating the complex interactions between gut-derived hormones and systemic metabolic functions. Researchers value its versatility and reliability for a broad spectrum of experimental models, particularly those focused on metabolic health, endocrinology, and cellular signaling.

Metabolic Research: GLP-1(7-36) Acetate is frequently employed in metabolic research to explore the molecular mechanisms underlying glucose homeostasis. By acting as an agonist at the GLP-1 receptor, the peptide facilitates studies on insulinotropic effects, glucose-stimulated insulin secretion, and the modulation of pancreatic beta cell activity. This enables researchers to dissect the pathways involved in glucose uptake, glycogen synthesis, and the suppression of glucagon release, providing critical insights into the regulation of blood sugar levels. Experimental models utilizing this peptide have contributed significantly to the understanding of metabolic disorders and the identification of novel therapeutic targets for metabolic dysregulation.

Appetite and Satiety Regulation: In neuroendocrine studies, GLP-1(7-36) Acetate is utilized to investigate its role in appetite suppression and satiety signaling. Acting on central and peripheral receptors, it allows researchers to delineate the pathways through which gut hormones influence feeding behavior and energy intake. The peptide's ability to modulate hypothalamic circuits and vagal afferent signaling has been instrumental in advancing knowledge of the physiological controls governing hunger and fullness. Such research is pivotal for unraveling the neurobiological basis of eating behaviors and the development of interventions for overeating and weight management.

Beta Cell Function and Survival: The application of GLP-1(7-36) Acetate extends to studies examining pancreatic beta cell physiology. Its use enables detailed analysis of beta cell proliferation, differentiation, and apoptosis under various experimental conditions. By activating GLP-1 receptors on beta cells, the peptide aids in the assessment of intracellular signaling cascades, gene expression profiles, and cellular responses to metabolic stress. These investigations are crucial for understanding the preservation and regeneration of functional beta cell mass, which is central to maintaining optimal insulin production and secretion.

Cardiovascular Research: Researchers leverage GLP-1 analogs such as GLP-1(7-36) Acetate to probe cardiovascular functions and protective mechanisms. Studies often focus on the peptide's impact on endothelial function, myocardial metabolism, and vascular tone. Through receptor-mediated pathways, it is possible to investigate how GLP-1 influences nitric oxide production, oxidative stress responses, and cardiac contractility. These insights are valuable for exploring the interplay between metabolic hormones and cardiovascular health, especially in the context of metabolic syndrome and related complications.

Signal Transduction and Cellular Pathways: GLP-1(7-36) Acetate serves as a robust tool for dissecting intracellular signaling pathways activated by GLP-1 receptor engagement. Researchers utilize the peptide to map downstream effectors such as cyclic AMP, protein kinase A, and phosphoinositide 3-kinase pathways, thereby elucidating the broader impact of GLP-1 signaling on cellular metabolism, gene transcription, and cell survival. Such mechanistic studies are fundamental for advancing our understanding of hormone-receptor interactions and their implications for cellular function across diverse tissue types.

Overall, GLP-1(7-36) Acetate's broad utility in metabolic research, appetite regulation, beta cell biology, cardiovascular studies, and signal transduction underscores its significance as a research reagent. Its use continues to drive scientific discovery in the fields of endocrinology, metabolism, and cellular physiology, offering researchers a reliable means to explore the multifaceted roles of incretin hormones in health and disease models.

Long-term Storage Conditions
H2O : 50 mg/mL (14.73 mM; Need ultrasonic)
DMSO : < 1 mg/mL (insoluble or slightly soluble)
Shipping Condition
Wet ice in continental US; may vary elsewhere
InChI
InChI=1S/C149H226N40O45.C2H4O2/c1-17-76(10)119(146(232)167-80(14)126(212)175-104(60-86-63-159-91-36-25-24-35-89(86)91)136(222)177-100(56-73(4)5)137(223)186-117(74(6)7)144(230)174-93(37-26-28-52-150)128(214)160-65-110(197)168-92(122(154)208)39-30-54-158-149(155)156)188-138(224)102(57-83-31-20-18-21-32-83)178-133(219)98(47-51-115(204)205)173-132(218)94(38-27-29-53-151)170-124(210)78(12)164-123(209)77(11)166-131(217)97(44-48-109(153)196)169-111(198)66-161-130(216)96(46-50-114(202)203)172-134(220)99(55-72(2)3)176-135(221)101(59-85-40-42-88(195)43-41-85)179-141(227)106(68-190)182-143(229)108(70-192)183-145(231)118(75(8)9)187-140(226)105(62-116(206)207)180-142(228)107(69-191)184-148(234)121(82(16)194)189-139(225)103(58-84-33-22-19-23-34-84)181-147(233)120(81(15)193)185-112(199)67-162-129(215)95(45-49-113(200)201)171-125(211)79(13)165-127(213)90(152)61-87-64-157-71-163-87;1-2(3)4/h18-25,31-36,40-43,63-64,71-82,90,92-108,117-121,159,190-195H,17,26-30,37-39,44-62,65-70,150-152H2,1-16H3,(H2,153,196)(H2,154,208)(H,157,163)(H,160,214)(H,161,216)(H,162,215)(H,164,209)(H,165,213)(H,166,217)(H,167,232)(H,168,197)(H,169,198)(H,170,210)(H,171,211)(H,172,220)(H,173,218)(H,174,230)(H,175,212)(H,176,221)(H,177,222)(H,178,219)(H,179,227)(H,180,228)(H,181,233)(H,182,229)(H,183,231)(H,184,234)(H,185,199)(H,186,223)(H,187,226)(H,188,224)(H,189,225)(H,200,201)(H,202,203)(H,204,205)(H,206,207)(H4,155,156,158);1H3,(H,3,4)/t76-,77-,78-,79-,80-,81+,82+,90-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,117-,118-,119-,120-,121-;/m0./s1
InChI Key
BCNDXSMWLGNKFT-AMEUXXCWSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicescGMP Peptide ServicePeptide Analysis ServicesPeptide Modification ServicesPeptide Nucleic Acids SynthesisCustom Conjugation ServicePeptide CDMOEpitope Mapping Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers