GLP-1(7-36) Acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.
CAT No:10-101-293
CAS No:1119517-19-9
Synonyms/Alias:Human GLP-1-(7-36)-amide Acetate
Quick InquiryCustom Peptide SynthesisPeptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C149H226N40O45.xC2H4O2 |
M.W/Mr. | 3394.67 |
Sequence | One Letter Code: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR Three Letter Code: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
Purity | > 98% |
Long-term Storage Conditions | H2O : 50 mg/mL (14.73 mM; Need ultrasonic) DMSO : < 1 mg/mL (insoluble or slightly soluble) |
Shipping Condition | Wet ice in continental US; may vary elsewhere |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.