GLP-1(7-36) Acetate

GLP-1(7-36) Acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.

Online Inquiry

CAT#10-101-293
CAS1119517-19-9
Synonyms/AliasHuman GLP-1-(7-36)-amide Acetate
M.F/FormulaC149H226N40O45.xC2H4O2
M.W/Mr.3394.67
SequenceOne Letter Code: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Three Letter Code: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
Purity> 98%
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Contact Us

Address:

Tel: |

Email:

Copyright © 2022 Creative Peptides. All rights reserved.