GLP-1(7-36) Acetate

GLP-1(7-36) Acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
GLP-1(7-36) Acetate(CAS 1119517-19-9)

CAT No: 10-101-293

CAS No:1119517-19-9

Synonyms/Alias:GLP-1(7-36) Acetate;1119517-19-9;DA-63787;F85454;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C151H230N40O47
M.W/Mr.
3357.7
Sequence
One Letter Code:HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Three Letter Code:H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2.CH3CO2H
Purity
> 98%

GLP-1(7-36) Acetate is a synthetic peptide fragment corresponding to the biologically active region of the glucagon-like peptide-1 (GLP-1), a critical incretin hormone involved in glucose homeostasis. As a 30-amino acid peptide, GLP-1(7-36) represents the major circulating form of GLP-1, renowned for its potent insulinotropic activity and regulatory effects on pancreatic β-cell function. Its biochemical significance lies in its ability to bind and activate the GLP-1 receptor, a G protein-coupled receptor widely expressed in pancreatic, neural, and gastrointestinal tissues. Owing to its well-characterized structure and functional relevance, this peptide serves as a foundational tool in metabolic, endocrinological, and pharmacological research, enabling the detailed investigation of incretin biology and receptor-mediated signaling pathways.

Receptor binding studies: GLP-1(7-36) Acetate is extensively utilized in receptor pharmacology to characterize the binding affinity, specificity, and downstream signaling of the GLP-1 receptor. By serving as a reference agonist, it enables researchers to delineate receptor-ligand interactions, quantify receptor expression, and assess the efficacy of novel receptor modulators or antagonists in various in vitro and cell-based assay systems. These studies provide essential insights into the molecular determinants of GLP-1 receptor activation and facilitate the screening of candidate compounds for metabolic research applications.

Signal transduction analysis: The peptide is a valuable probe for dissecting intracellular signaling cascades initiated by GLP-1 receptor activation. Application of GLP-1(7-36) in cultured cells or tissue explants allows for the quantitative assessment of second messenger production, such as cyclic AMP accumulation, as well as the activation of downstream kinases including PKA and ERK. Such analyses are critical for elucidating the molecular mechanisms underlying insulin secretion, β-cell survival, and other GLP-1-mediated physiological responses, supporting the development of new hypotheses in cellular endocrinology.

Metabolic pathway research: GLP-1(7-36) Acetate is widely adopted in metabolic studies to investigate the regulation of glucose-stimulated insulin secretion, glucagon suppression, and related metabolic processes. Its use in isolated islet preparations, perfused pancreas models, or engineered cell lines enables precise analysis of peptide-mediated effects on hormone release, glucose uptake, and energy homeostasis. These experimental systems help clarify the peptide's role in nutrient sensing and metabolic adaptation, informing broader research into diabetes and metabolic syndrome pathophysiology.

Peptide stability and degradation studies: The acetate salt form of GLP-1(7-36) is frequently employed to study peptide stability, enzymatic degradation, and the pharmacokinetics of incretin hormones. Researchers utilize this compound to examine the kinetics of dipeptidyl peptidase-4 (DPP-4) cleavage, investigate protective modifications, or evaluate the impact of chemical environment on peptide half-life. Such studies are fundamental for the rational design of more stable peptide analogs and for understanding the factors governing endogenous GLP-1 bioavailability.

Peptide synthesis and analytical standard: As a well-defined peptide with established bioactivity, GLP-1(7-36) Acetate serves as a benchmark standard in peptide synthesis, purification, and quality control workflows. It is commonly used to validate analytical methods such as high-performance liquid chromatography (HPLC), mass spectrometry, and peptide mapping, ensuring the accuracy and reproducibility of peptide-based research protocols. The availability of this standard supports method development and troubleshooting in both academic and industrial peptide research laboratories.

Long-term Storage Conditions
H2O : 50 mg/mL (14.73 mM; Need ultrasonic)
DMSO : < 1 mg/mL (insoluble or slightly soluble)
Shipping Condition
Wet ice in continental US; may vary elsewhere
InChI
InChI=1S/C149H226N40O45.C2H4O2/c1-17-76(10)119(146(232)167-80(14)126(212)175-104(60-86-63-159-91-36-25-24-35-89(86)91)136(222)177-100(56-73(4)5)137(223)186-117(74(6)7)144(230)174-93(37-26-28-52-150)128(214)160-65-110(197)168-92(122(154)208)39-30-54-158-149(155)156)188-138(224)102(57-83-31-20-18-21-32-83)178-133(219)98(47-51-115(204)205)173-132(218)94(38-27-29-53-151)170-124(210)78(12)164-123(209)77(11)166-131(217)97(44-48-109(153)196)169-111(198)66-161-130(216)96(46-50-114(202)203)172-134(220)99(55-72(2)3)176-135(221)101(59-85-40-42-88(195)43-41-85)179-141(227)106(68-190)182-143(229)108(70-192)183-145(231)118(75(8)9)187-140(226)105(62-116(206)207)180-142(228)107(69-191)184-148(234)121(82(16)194)189-139(225)103(58-84-33-22-19-23-34-84)181-147(233)120(81(15)193)185-112(199)67-162-129(215)95(45-49-113(200)201)171-125(211)79(13)165-127(213)90(152)61-87-64-157-71-163-87;1-2(3)4/h18-25,31-36,40-43,63-64,71-82,90,92-108,117-121,159,190-195H,17,26-30,37-39,44-62,65-70,150-152H2,1-16H3,(H2,153,196)(H2,154,208)(H,157,163)(H,160,214)(H,161,216)(H,162,215)(H,164,209)(H,165,213)(H,166,217)(H,167,232)(H,168,197)(H,169,198)(H,170,210)(H,171,211)(H,172,220)(H,173,218)(H,174,230)(H,175,212)(H,176,221)(H,177,222)(H,178,219)(H,179,227)(H,180,228)(H,181,233)(H,182,229)(H,183,231)(H,184,234)(H,185,199)(H,186,223)(H,187,226)(H,188,224)(H,189,225)(H,200,201)(H,202,203)(H,204,205)(H,206,207)(H4,155,156,158);1H3,(H,3,4)/t76-,77-,78-,79-,80-,81+,82+,90-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,117-,118-,119-,120-,121-;/m0./s1
InChI Key
BCNDXSMWLGNKFT-AMEUXXCWSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServiceCustom Conjugation ServicePeptide Nucleic Acids SynthesisPeptide Analysis ServicesPeptide Synthesis ServicesPeptide Modification ServicesEpitope Mapping ServicesPeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers